Comparing GFF997 FitnessBrowser__Phaeo:GFF997 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
31% identity, 97% coverage: 8:383/388 of query aligns to 6:374/380 of 7rsfA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
27% identity, 83% coverage: 66:386/388 of query aligns to 58:374/377 of 7t1qA
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 78% coverage: 71:372/388 of query aligns to 72:367/383 of 7uoiA
7lgpB Dape enzyme from shigella flexneri
24% identity, 82% coverage: 69:386/388 of query aligns to 63:375/377 of 7lgpB
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
26% identity, 82% coverage: 69:386/388 of query aligns to 62:374/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
26% identity, 82% coverage: 69:386/388 of query aligns to 62:374/375 of 4pqaA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
26% identity, 77% coverage: 74:373/388 of query aligns to 72:352/366 of Q8P8J5
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 68% coverage: 10:273/388 of query aligns to 24:302/426 of 3pfoA
Sites not aligning to the query:
Q96KP4 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Peptidase A; Threonyl dipeptidase; EC 3.4.13.18 from Homo sapiens (Human)
42% identity, 23% coverage: 69:158/388 of query aligns to 94:186/475 of Q96KP4
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 56% coverage: 66:284/388 of query aligns to 63:269/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 56% coverage: 66:284/388 of query aligns to 59:265/377 of P44514
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
26% identity, 77% coverage: 74:373/388 of query aligns to 73:347/360 of 2f7vA
2zogA Crystal structure of mouse carnosinase cn2 complexed with zn and bestatin (see paper)
41% identity, 23% coverage: 69:158/388 of query aligns to 98:190/478 of 2zogA
Sites not aligning to the query:
2zofA Crystal structure of mouse carnosinase cn2 complexed with mn and bestatin (see paper)
41% identity, 23% coverage: 69:158/388 of query aligns to 98:190/478 of 2zofA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
41% identity, 23% coverage: 69:158/388 of query aligns to 94:186/475 of Q9D1A2
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 52% coverage: 68:267/388 of query aligns to 74:278/407 of P37111
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
28% identity, 38% coverage: 52:199/388 of query aligns to 78:230/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
29% identity, 35% coverage: 52:185/388 of query aligns to 109:244/507 of Q96KN2
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
33% identity, 29% coverage: 66:179/388 of query aligns to 61:183/258 of 4h2kA
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
32% identity, 27% coverage: 70:173/388 of query aligns to 121:235/503 of Q8C165
Sites not aligning to the query:
>GFF997 FitnessBrowser__Phaeo:GFF997
MADQLTPLEIMTKLISFPTVSSETNLPLVDWVEGYLASHGITAHRWVDPDQPHKAAVFAH
VGPDVEGAVVLSGHTDVVPIEGQPWDSDPFTVVERDGKYFGRGTCDMKGFDALAIWALVA
AHHRGVARPLQLALSFDEEVGCTGAPPMIVAMQDVLPKGSCVIVGEPSVMRPVTGHKGGI
GYSTHLVGFEVHSSLMHTGVSAIMQGARLIDWANARNAENMAKTPDDVAALFTPPFTTCH
VGMINGGTAHNITAKDCRFVMDFRVVPGESAAEWEAAYLAKVRDIEAEMQVVHPDTRIDV
SKKFNVPGLVPEVEGEAETLVRALTGDNGTHVVSYGTEAGQFQEAGYSAVICGPGDIAQA
HQPNEYIDVSQFNAGHRFMQQLIDRLAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory