SitesBLAST
Comparing Ga0059261_1576 FitnessBrowser__Korea:Ga0059261_1576 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gljA Crystal structure of methylthioadenosine phosphorylase in complex with rhodamine b (see paper)
47% identity, 90% coverage: 6:266/289 of query aligns to 6:269/287 of 4gljA
- active site: D212 (= D209), D214 (= D211)
- binding N-[9-(2-carboxyphenyl)-6-(diethylamino)-3H-xanthen-3-ylidene]-N-ethylethanaminium: S12 (= S12), Y15 (= Y15), H55 (= H55), A88 (≠ S88), G90 (= G90), F169 (= F166), F169 (= F166), I186 (= I183), G187 (= G184), M188 (= M185), D212 (= D209), F213 (≠ Y210), D214 (= D211), N219 (≠ E216), A228 (≠ V225), I229 (= I226), L232 (= L229)
3t94A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase (mtap) ii complexed with 5'-deoxy-5'-methylthioadenosine and sulfate (see paper)
46% identity, 90% coverage: 6:265/289 of query aligns to 10:270/270 of 3t94A
- active site: S16 (= S12), P39 (≠ A35), H63 (= H59), I65 (≠ L61), P66 (≠ S62), A92 (≠ S88), M190 (= M185), T191 (= T186), D214 (= D209), D216 (= D211), A225 (≠ V222)
- binding 5'-deoxy-5'-methylthioadenosine: G94 (= G90), F170 (= F166), I188 (= I183), M190 (= M185), D214 (= D209), A225 (≠ V222), V228 (= V225)
Q97W94 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPII; EC 2.4.2.28 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
46% identity, 90% coverage: 6:265/289 of query aligns to 10:270/270 of Q97W94
- C138 (= C134) modified: Disulfide link with 205
- C200 (≠ R195) modified: Disulfide link with 262
- C205 (≠ P200) modified: Disulfide link with 138
- C259 (≠ I256) modified: Disulfide link with 261; mutation to S: Reduces thermostability of the enzyme; when associated with S-261.
- C261 (≠ T258) modified: Disulfide link with 259; mutation to S: Reduces thermostability of the enzyme; when associated with S-259.
- C262 (= C259) modified: Disulfide link with 200; mutation to S: Reduces thermostability of the enzyme.
5eubA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with 2-amino-mta and sulfate
44% identity, 84% coverage: 6:249/289 of query aligns to 3:248/272 of 5eubA
- active site: T9 (≠ S12), P32 (≠ A35), H56 (= H59), I58 (≠ L61), M59 (≠ S62), A85 (≠ S88), M187 (= M185), T188 (= T186), D211 (= D209), D213 (= D211), V224 (= V222)
- binding (2~{R},3~{R},4~{S},5~{S})-2-[2,6-bis(azanyl)purin-9-yl]-5-(methylsulfanylmethyl)oxolane-3,4-diol: A85 (≠ S88), C86 (≠ V89), G87 (= G90), F168 (= F166), I185 (= I183), N186 (≠ G184), T210 (= T208), D211 (= D209), D213 (= D211), V227 (= V225)
6dz3A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
44% identity, 84% coverage: 6:249/289 of query aligns to 4:249/273 of 6dz3A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-butyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: T84 (≠ V86), A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211), V228 (= V225), L232 (= L229)
6dyzA Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((prop-2-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
44% identity, 84% coverage: 6:249/289 of query aligns to 4:249/273 of 6dyzA
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(prop-2-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S12), H57 (= H59), A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211), V228 (= V225)
- binding phosphate ion: G9 (= G11), T10 (≠ S12), R52 (= R54), H53 (= H55), T85 (≠ S87), A86 (≠ S88), T189 (= T186)
5tc8A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with methylthio-dadme-immucillin-a
44% identity, 84% coverage: 6:249/289 of query aligns to 4:249/273 of 5tc8A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3r,4s)-1-[(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(methylsulfanyl)methyl]pyrrolidin-3-ol: T10 (≠ S12), A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), I186 (= I183), N187 (≠ G184), M188 (= M185), T211 (= T208), D212 (= D209), D214 (= D211), V228 (= V225)
5tc6A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with propylthio-immucillin-a
44% identity, 84% coverage: 6:249/289 of query aligns to 4:249/273 of 5tc6A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (2S,3S,4R,5S)-2-(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(propylsulfanyl)methyl]pyrrolidine-3,4-diol: T10 (≠ S12), A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), N187 (≠ G184), M188 (= M185), D212 (= D209), V225 (= V222), V228 (= V225), L229 (≠ I226)
3ozcA Crystal structure of human 5'-deoxy-5'-methyladenosine phosphorylase in complex with pcl-phenylthiodadmeimma
44% identity, 84% coverage: 6:249/289 of query aligns to 4:249/273 of 3ozcA
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V225 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(4-chlorophenyl)sulfanyl]methyl}pyrrolidin-3-ol: T10 (≠ S12), H57 (= H59), A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211), V228 (= V225), L229 (≠ I226)
6dz0A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-((pent-4-yn-1-ylthio)methyl)pyrrolidin-3- ol (see paper)
44% identity, 84% coverage: 6:249/289 of query aligns to 6:251/274 of 6dz0A
- active site: T12 (≠ S12), P35 (≠ A35), H59 (= H59), I61 (≠ L61), M62 (≠ S62), A88 (≠ S88), M190 (= M185), T191 (= T186), D214 (= D209), D216 (= D211), V227 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-{[(pent-4-yn-1-yl)sulfanyl]methyl}pyrrolidin-3-ol: T12 (≠ S12), H59 (= H59), A88 (≠ S88), C89 (≠ V89), G90 (= G90), F171 (= F166), I188 (= I183), N189 (≠ G184), M190 (= M185), T213 (= T208), D214 (= D209), D216 (= D211), V227 (= V222), V230 (= V225)
- binding phosphate ion: G11 (= G11), T12 (≠ S12), R54 (= R54), H55 (= H55), T87 (≠ S87), T191 (= T186)
5tc5A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride
44% identity, 84% coverage: 6:249/289 of query aligns to 17:262/286 of 5tc5A
- active site: T23 (≠ S12), P46 (≠ A35), H70 (= H59), I72 (≠ L61), M73 (≠ S62), A99 (≠ S88), M201 (= M185), T202 (= T186), D225 (= D209), D227 (= D211), V238 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-[(butylsulfanyl)methyl]pyrrolidin-3-ol: A99 (≠ S88), C100 (≠ V89), G101 (= G90), F182 (= F166), I199 (= I183), M201 (= M185), D225 (= D209), D227 (= D211), V241 (= V225)
1wtaA Crystal structure of 5'-deoxy-5'-methylthioadenosine from aeropyrum pernix (r32 form)
48% identity, 87% coverage: 5:254/289 of query aligns to 11:263/273 of 1wtaA
1sd2A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-methylthiotubercidin (see paper)
45% identity, 84% coverage: 6:249/289 of query aligns to 4:238/262 of 1sd2A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M182 (= M185), T183 (= T186), D206 (= D209), D208 (= D211), V214 (= V222)
- binding 2-(4-amino-pyrrolo[2,3-d]pyrimidin-7-yl)-5-methylsulfanylmethyl-tetrahydro-furan-3,4-diol: C87 (≠ V89), G88 (= G90), F163 (= F166), I180 (= I183), N181 (≠ G184), M182 (= M185), D206 (= D209), V217 (= V225)
1k27A Crystal structure of 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with a transition state analogue (see paper)
44% identity, 84% coverage: 6:249/289 of query aligns to 4:246/270 of 1k27A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V222 (= V222)
- binding (3s,4r)-2-(4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)-5-[(methylsulfanyl)methyl]pyrrolidine-3,4-diol: A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), N187 (≠ G184), M188 (= M185), D212 (= D209), V225 (= V225)
- binding phosphate ion: G9 (= G11), T10 (≠ S12), R52 (= R54), H53 (= H55), T85 (≠ S87), A86 (≠ S88), T189 (= T186)
6dz2A Crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2- d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl) propyl)thio)methyl)pyrrolidin-3-ol (see paper)
43% identity, 84% coverage: 6:249/289 of query aligns to 4:246/270 of 6dz2A
- active site: T10 (≠ S12), P33 (≠ A35), I56 (≠ L61), M57 (≠ S62), A83 (≠ S88), M185 (= M185), T186 (= T186), D209 (= D209), D211 (= D211), V222 (= V222)
- binding (3R,4S)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-({[3-(1-benzyl-1H-1,2,3-triazol-4-yl)propyl]sulfanyl}methyl)pyrrolidin-3-ol: G8 (= G10), T10 (≠ S12), T81 (≠ V86), T82 (≠ S87), A83 (≠ S88), C84 (≠ V89), G85 (= G90), F166 (= F166), I183 (= I183), N184 (≠ G184), M185 (= M185), D209 (= D209), L229 (= L229)
1sd1A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with formycin a (see paper)
43% identity, 84% coverage: 6:249/289 of query aligns to 4:244/268 of 1sd1A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V220 (= V222)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), I186 (= I183), N187 (≠ G184), M188 (= M185), D212 (= D209), D214 (= D211)
1cg6A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase complexed with 5'-deoxy-5'-methylthioadenosine and sulfate at 1.7 a resolution (see paper)
43% identity, 84% coverage: 6:249/289 of query aligns to 4:244/268 of 1cg6A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V220 (= V222)
- binding 5'-deoxy-5'-methylthioadenosine: A86 (≠ S88), C87 (≠ V89), G88 (= G90), F169 (= F166), N187 (≠ G184), M188 (= M185), D212 (= D209), V223 (= V225)
- binding sulfate ion: G9 (= G11), T10 (≠ S12), R52 (= R54), H53 (= H55), T85 (≠ S87), T189 (= T186)
1cb0A Structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase at 1.7 a resolution (see paper)
43% identity, 84% coverage: 6:249/289 of query aligns to 4:244/268 of 1cb0A
- active site: T10 (≠ S12), P33 (≠ A35), H57 (= H59), I59 (≠ L61), M60 (≠ S62), A86 (≠ S88), M188 (= M185), T189 (= T186), D212 (= D209), D214 (= D211), V220 (= V222)
- binding adenine: C87 (≠ V89), G88 (= G90), F169 (= F166), D212 (= D209), D214 (= D211)
Q8U4Q8 S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; PfMTAP; EC 2.4.2.28 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
43% identity, 86% coverage: 6:253/289 of query aligns to 4:246/257 of Q8U4Q8
- C130 (= C134) modified: Disulfide link with 195
- C195 (≠ P200) modified: Disulfide link with 130
- C246 (≠ A253) modified: Disulfide link with 248
Sites not aligning to the query:
- 248 modified: Disulfide link with 246
5f7jB Crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine (see paper)
40% identity, 83% coverage: 1:240/289 of query aligns to 1:261/291 of 5f7jB
- active site: K34 (≠ E34), H59 (= H59), D230 (= D209), D232 (= D211)
- binding adenine: A88 (≠ S88), C89 (≠ V89), G90 (= G90), F187 (= F166), V204 (≠ I183), N205 (≠ G184), M206 (= M185), D230 (= D209), D232 (= D211), V246 (= V225)
Query Sequence
>Ga0059261_1576 FitnessBrowser__Korea:Ga0059261_1576
VSGWHIGIIGGSGLYDVEGIERGEWVTVASPWGEASDAIFTGRMGHARVSFLPRHGRGHR
LSPSQLNNRANIDCLKRMGVTDVLAVSSVGGLTEERAPGTFTVADQFIDRTKGRPSSFYG
SGMVAHVSMADPVCPRLSQFAAAAARAAGAQVHAGGTYLAMEGPQFSTRAESHLYRSWGC
DIIGMTAMPEARLAREAELPYALVGMVTDYDCWREEEAAVDVAQVIEQLSSNAAKARAMV
TALLHGLPETREASPIDTCLDAALITVPSARDPALLAKLDAVAGRVLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory