SitesBLAST
Comparing Ga0059261_2137 FitnessBrowser__Korea:Ga0059261_2137 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2onjA Structure of the multidrug abc transporter sav1866 from s. Aureus in complex with amp-pnp (see paper)
33% identity, 82% coverage: 96:584/597 of query aligns to 91:577/578 of 2onjA
- binding phosphoaminophosphonic acid-adenylate ester: Y349 (= Y355), I356 (≠ L362), S376 (= S382), G377 (= G383), G378 (≠ S384), G379 (= G385), K380 (= K386), S381 (≠ T387), T382 (= T388), Q422 (= Q428), K477 (= K483), S479 (= S485), G480 (= G486), E503 (= E509), H534 (= H540)
2hydA Multidrug abc transporter sav1866 (see paper)
33% identity, 82% coverage: 96:584/597 of query aligns to 91:577/578 of 2hydA
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 107:592/600 of 4mrvA
- binding mercury bis(L-gamma-glutamyl-3-sulfido-L-alanylglycine): Y149 (≠ D141), L261 (≠ S253), N262 (≠ G254), Q265 (= Q257), D309 (≠ V301), M310 (≠ D302), L311 (≠ V303), G312 (= G304), M313 (≠ F305)
- binding phosphate ion: M313 (≠ F305), R316 (≠ H308), S389 (= S382), G392 (= G385), S394 (≠ T387)
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 107:592/600 of 4mrsA
- binding oxidized glutathione disulfide: K142 (≠ W134), Y149 (≠ D141), R199 (≠ A191), R203 (≠ A195), L261 (≠ S253), N262 (≠ G254), Q265 (= Q257), D309 (≠ V301), M310 (≠ D302), G312 (= G304), M313 (≠ F305)
- binding phosphate ion: S389 (= S382), G392 (= G385), S394 (≠ T387)
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 107:592/600 of 4mrpA
- binding glutathione: Y149 (≠ D141), L261 (≠ S253), N262 (≠ G254), Q265 (= Q257), D309 (≠ V301), M310 (≠ D302), M310 (≠ D302), L311 (≠ V303), G312 (= G304), M313 (≠ F305)
- binding phosphate ion: S389 (= S382), G390 (= G383), G392 (= G385), S394 (≠ T387)
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 107:592/600 of 4mrnA
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 93:578/578 of 6parA
- binding phosphoaminophosphonic acid-adenylate ester: Y349 (= Y355), R353 (≠ T360), I355 (≠ L362), S375 (= S382), G376 (= G383), G378 (= G385), K379 (= K386), S380 (≠ T387), T381 (= T388), K476 (= K483), S478 (= S485), G479 (= G486), G480 (= G487), E481 (= E488)
- binding magnesium ion: S380 (≠ T387), Q421 (= Q428)
6pamA Structure of a bacterial atm1-family abc transporter with mgadp bound (see paper)
36% identity, 81% coverage: 99:584/597 of query aligns to 102:585/586 of 6pamA
Q2G506 ATM1-type heavy metal exporter; ATP-binding cassette transporter Atm1; NaAtm1; EC 7.-.-.- from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199) (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 114:599/608 of Q2G506
- Y195 (= Y179) mutation to F: Strongly increases basal rate of ATP hydrolysis.
- N269 (≠ G254) mutation to A: Increases basal rate of ATP hydrolysis and abolishes stimulation of ATP hydrolysis by glutathione.
- NIAQ 269:272 (≠ GSAQ 254:257) binding
- Q272 (= Q257) mutation to A: Abolishes glutathione-dependent ATP hydrolysis.
- DMLG 316:319 (≠ VDVG 301:304) binding
- G319 (= G304) mutation to L: Abolishes glutathione-dependent ATP hydrolysis.
- E523 (= E509) mutation to Q: Abolishes transporter activity.
6panA Structure of a bacterial atm1-family abc exporter with atp bound (see paper)
36% identity, 82% coverage: 99:586/597 of query aligns to 84:569/572 of 6panA
- binding adenosine-5'-triphosphate: Y340 (= Y355), R344 (≠ T360), I346 (≠ L362), S366 (= S382), G367 (= G383), K370 (= K386), S371 (≠ T387), T372 (= T388), K467 (= K483), S469 (= S485), G470 (= G486), E472 (= E488), H524 (= H540)
8k7bA Post-occluded structure of human abcb6 w546a mutant (adp/vo4-bound) (see paper)
33% identity, 84% coverage: 82:585/597 of query aligns to 92:590/590 of 8k7bA
- binding adp orthovanadate: Y362 (= Y355), G389 (= G383), G391 (= G385), K392 (= K386), S393 (≠ T387), T394 (= T388), K489 (= K483), L490 (= L484), S491 (= S485), G492 (= G486), H546 (= H540)
- binding magnesium ion: S393 (≠ T387), Q434 (= Q428)
7dnyB Cryo-em structure of the human abcb6 (coproporphyrin iii-bound) (see paper)
33% identity, 85% coverage: 82:586/597 of query aligns to 76:575/575 of 7dnyB
Sites not aligning to the query:
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
35% identity, 84% coverage: 82:583/597 of query aligns to 329:825/842 of Q9DC29
- L356 (≠ F112) mutation to P: Results in retention of the protein in the Golgi apparatus.
- G579 (≠ D335) mutation to E: Results in retention of the protein in the Golgi apparatus.
Sites not aligning to the query:
- 170 S→G: Results in retention of the protein in the Golgi apparatus.
7eklA Mitochondrial outer membrane protein (see paper)
33% identity, 84% coverage: 82:585/597 of query aligns to 92:590/590 of 7eklA
- binding adenosine-5'-triphosphate: Y362 (= Y355), R366 (≠ H358), G389 (= G383), A390 (≠ S384), G391 (= G385), K392 (= K386), S393 (≠ T387), F475 (≠ L469), K489 (= K483), L490 (= L484), S491 (= S485), E494 (= E488), H546 (= H540)
- binding magnesium ion: S393 (≠ T387), Q434 (= Q428)
Q9NP58 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; Mitochondrial ABC transporter 3; Mt-ABC transporter 3; P-glycoprotein-related protein; Ubiquitously-expressed mammalian ABC half transporter; EC 7.6.2.5 from Homo sapiens (Human) (see 11 papers)
33% identity, 85% coverage: 82:586/597 of query aligns to 329:828/842 of Q9NP58
- L356 (≠ F112) to P: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514756
- N447 (≠ T203) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-498; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-498; Q-677 and Q-775.
- A492 (≠ M248) to T: may be a modifier of disease severity in porphyria patients; increases expression; does not affect substrate binding; impairs ATP-binding; Loss of ATP-dependent coproporphyrin III transport; Highly decrease plasma membrane expression; dbSNP:rs147445258
- N498 (≠ G254) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-677 and Q-775.
- T521 (≠ W277) to S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs149363094
- V531 (= V289) mutation to A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- M542 (≠ L300) mutation to A: Loss of substrate-stimulate ATPase activity.
- W546 (≠ G304) mutation to A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.; mutation to F: Does not affect substrate-stimulate ATPase activity.; mutation to V: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- G579 (≠ D335) to E: in DUH3; the protein is retained in the Golgi apparatus. Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins.; dbSNP:rs397514758
- G588 (= G344) to S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs145526996
- Y599 (= Y355) binding
- 623:634 (vs. 380:391, 50% identical) binding
- K629 (= K386) mutation to A: Abolishes ATP hydrolysis. Abolishes coproporphyrin III transport.; mutation to M: Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins. Fails to rescue vacuolar sequestration of cadmium in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Fails to rescue the cadmium tolerance in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Does not rescue vacuolar cadmium levels in hmt-1 mutant S.pombe.
- N677 (≠ H434) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498; and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498; and Q-775.
- A681 (= A438) to T: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs142421126
- N775 (≠ G532) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498 and Q-677. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498 and Q-677.
- L811 (= L568) to V: in MCOPCB7; hypomorphic mutation; dbSNP:rs387906910
Sites not aligning to the query:
- 1:205 Required for the lysosomal targeting
- 1:236 Required for ATPase activity
- 6 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Loss of N-glycosylation; when associated with Q-447; Q-498; Q-677 and Q-775. Does not affect substrate binding.
- 8 modified: Disulfide link with 26; C→G: Loss of N-glycosylation.; C→S: Does not affect substrate binding. Does not affect N-glycosylation. Impairs endoplasmic reticulum exit. Impairs endoplasmic reticulum exit; when associated with C-8. Increases ABCB6 proteasomal degradation. Affects protein stability. Does not affect migration in the presence of DTT; when associated with A-50 and A-120.
- 26 modified: Disulfide link with 8; C→A: Decreases protein expression. Affects protein stability. Loss of ability to stimulate porphyrin synthesis.; C→S: Decreases protein expression. Impairs endoplasmic reticulum exit; when associated with C-8. Affects protein stability.
- 50 C→A: Increases migration in the absence of DTT; when associated with A-120. Reduces migration in with the presence of DTT; when associated with A-120.
- 57 A → T: in MCOPCB7; uncertain significance; hypomorphic mutation; dbSNP:rs387906911
- 69 R → G: in a breast cancer sample; somatic mutation
- 120 C→A: Increases migration in the absence of DTT; when associated with A-50. Reduces migration in with the presence of DTT; when associated with A-50.
- 170 S → G: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514757
- 192 R → Q: decrease expression; does not affect substrate binding; does not affect ATP-binding; loss of plasma membrane expression; dbSNP:rs150221689
- 276 R → W: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs57467915
- 286 Y→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
7dnzB Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
33% identity, 84% coverage: 82:583/597 of query aligns to 94:590/591 of 7dnzB
Sites not aligning to the query:
7dnzA Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
33% identity, 84% coverage: 82:583/597 of query aligns to 94:590/591 of 7dnzA
O75027 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Homo sapiens (Human) (see 4 papers)
32% identity, 99% coverage: 3:595/597 of query aligns to 113:721/752 of O75027
- R315 (≠ A191) natural variant: R -> G
- F346 (= F222) natural variant: F -> I
- E433 (≠ H309) to K: in ASAT; impaired maturation of cytosolic Fe/S proteins, loss of the ability to couple MgATP binding with stimulation of ATPase activity at the nucleotide binding domain;; loss of [2Fe-2S]-(GS)4 cluster transport; dbSNP:rs80356714; mutation to D: Significantly increases ATPase activity by [2Fe-2S]-(GS)4 cluster stimulation. Increases affinity for Mg-ATP. Does not affect affinity for Mg-ATP in the presence of the in the presence of [2Fe-2S]-(GS)4 cluster. Does not affect [2Fe-2S]-(GS)4 cluster transport.; mutation to K: Loss of ATPase activity stimulation by [2Fe-2S]-(GS)4 cluster stimulation. Loss of the ability to couple MgATP binding with stimulation of ATPase activity at the nucleotide binding domain. Loss of [2Fe-2S]-(GS)4 cluster transport.; mutation to Q: Loss of ATPase activity stimulation by [2Fe-2S]-(GS)4 cluster stimulation. Loss of the ability to couple MgATP binding with stimulation of ATPase activity at the nucleotide binding domain. Loss of [2Fe-2S]-(GS)4 cluster transport.
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 84% coverage: 95:595/597 of query aligns to 228:728/728 of Q9LVM1
- R612 (= R480) mutation to K: Resistant to sirtinol and reduced chlorophyll content.
7a6fA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and zosuquidar (see paper)
33% identity, 82% coverage: 96:584/597 of query aligns to 93:581/1164 of 7a6fA
Sites not aligning to the query:
- binding cholesterol: 607, 615, 618, 646, 727, 731, 744, 747, 748
- binding Zosuquidar: 34, 34, 613, 764, 767, 838, 841, 874, 878, 879
Query Sequence
>Ga0059261_2137 FitnessBrowser__Korea:Ga0059261_2137
MTQDTDRTDSIRRVLGFAFRHWVRQPGRAAYIAFFITAATVTEIFVPLFAGRLIDALAGN
LRSEALALFAAMASLGLAMVVLRHFAWAGVVPFTLRMMRDVTQDGFHRVQRFSTDWHANS
FAGSTVRKITRGMWAFDTLNDVLLLQLLPSIAVLGGTMLLLGWHWPVLGVVMAIGAVAYV
AMTVVLATRWASPAATLSNAWDTKLGGMLSDAIGSNAVVKAFGAEEREEQRIGGLLAKWA
KRTRRTWMRYTWSGSAQIAVLWAIRSAITGTALWLWWTGAATPGDVTFVLASYFVVHGYL
VDVGFHIHHMQRAVNEMEELVDLHDQPLGIDDRTDAQPIHIGAGEVHFDDVTFRYGGHET
PLYEHLTLTIRGGERVGLVGHSGSGKTTFVKLIQRLYDVNEGRVTIDGQDVSHATQQSLR
AQIAIVQQEPILFHRSLADNIAYARPGASQAEVEAAARLANAHDFIVRLPRGYATLVGER
GVKLSGGERQRVALARAFLADAPILILDEATSSLDSESEALIQQAMDRLMKGRTAIVIAH
RLSTVRTLDRILVFDKGRIIEDGDHDTLLVNAGGQYRRLFDRQSGNIVDDAPKLEEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory