SitesBLAST
Comparing Ga0059261_3272 FitnessBrowser__Korea:Ga0059261_3272 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q92R43 Aquaglyceroporin AqpS from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
54% identity, 99% coverage: 3:220/221 of query aligns to 6:222/233 of Q92R43
- T49 (= T47) mutation T->F,W: Increases uptake of both methylarsenite and methylarsenate and exhibits higher sensitivity to methylarsenite.
- V177 (= V175) mutation to I: Decreases methylarsenite transport activity and results in higher resistance to methylarsenite. Slight decrease in methylarsenate transport activity.; mutation to R: Increases methylarsenite transport activity, leading to lower resistance to methylarsenite. Nearly complete loss of methylarsenate transport activity.
8ct2D Local refinement of aqp1 tetramer (c1; refinement mask included d1 of protein 4.2 and ankyrin-1 ar1-5) in class 2 of erythrocyte ankyrin-1 complex (see paper)
30% identity, 95% coverage: 5:215/221 of query aligns to 10:229/247 of 8ct2D
P30302 Aquaporin PIP2-3; Plasma membrane intrinsic protein 2-3; AtPIP2;3; Plasma membrane intrinsic protein 2c; PIP2c; RD28-PIP; TMP2C; Water stress-induced tonoplast intrinsic protein; WSI-TIP from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 70% coverage: 2:156/221 of query aligns to 34:208/285 of P30302
Sites not aligning to the query:
- 223 T→C: Creates some mercury-sensitivity.
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 70% coverage: 2:156/221 of query aligns to 34:208/285 of P43287
- R194 (vs. gap) mutation to A: Reduced sensitivity to cytosolic acidification. Insensitive to cytosolic acidification; when associated with A-197.
- D195 (≠ G143) mutation to A: Reduced sensitivity to cytosolic acidification. Insensitive to cytosolic acidification; when associated with A-197.
- H197 (= H145) mutation to A: Reduced water transport activity. Reduced sensitivity to cytosolic acidification. Insensitive to cytosolic acidification; when associated with A-194 or A-195.; mutation to D: Reduced water transport activity. Insensitive to cytosolic acidification.; mutation to K: Very low water transport activity. Insensitive to cytosolic acidification.
Sites not aligning to the query:
- 3 modified: N6,N6-dimethyllysine; partial
- 264 H→A: No effect.
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 70% coverage: 2:156/221 of query aligns to 36:210/287 of P43286
Sites not aligning to the query:
- 3 modified: N6,N6-dimethyllysine; partial; K→A: 2-fold decrease in water transport activity.; K→R: No effect.
- 6 E→A: No effect.
- 280 modified: Phosphoserine; S→A: Normal subcellular localization.
- 283 modified: Phosphoserine; S→A: Intracellular reticulation pattern, probably corresponding to the endoplasmic reticulum.; S→D: Normal subcellular localization.
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 99% coverage: 3:221/221 of query aligns to 47:264/298 of Q6Z2T3
- A132 (= A91) mutation to T: In lsi; impairs silicon uptake. Grain discoloration. Reduces grain yield 10-fold.
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
30% identity, 97% coverage: 1:215/221 of query aligns to 7:223/271 of P56402
- T126 (vs. gap) mutation to M: Does not cause loss of water channel activity, but impairs trafficking from cytoplasmic vesicles to the cell membrane.
Sites not aligning to the query:
- 256 modified: Phosphoserine; S → L: in cph; loss of a phosphorylation site and loss of trafficking to the apical cell membrane; causes aberrant location at the basolateral cell membrane
Q9XF58 Aquaporin PIP2-5; Plasma membrane intrinsic protein 2-5; ZmPIP2-5; ZmPIP2;5; ZmPIP2a from Zea mays (Maize) (see paper)
31% identity, 70% coverage: 2:156/221 of query aligns to 34:210/285 of Q9XF58
- G104 (≠ A64) mutation to W: Loss of water transport.
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
28% identity, 97% coverage: 1:215/221 of query aligns to 7:223/271 of P41181
- G64 (= G63) to R: in NDI2; loss of water channel activity; dbSNP:rs104894326
- G78 (≠ K77) mutation to A: Does not affect interaction with MIAC; when associated with A-79.
- C79 (≠ R78) mutation to A: Does not affect interaction with MIAC; when associated with A-78.
- S148 (vs. gap) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: Retained in the endoplasmic reticulum.
- R187 (= R179) to C: in NDI2; loss of water channel activity; mutant protein does not fold properly; dbSNP:rs104894328
- A190 (≠ S182) to T: in NDI2; mutant protein does not fold properly and is not functional; dbSNP:rs104894341
- V194 (≠ A186) to I: in dbSNP:rs772051028
- S216 (≠ L208) to P: in NDI2; loss of water channel activity; dbSNP:rs104894329
- L217 (= L209) mutation to A: Abolishes interaction with MIAC; when associated with A-221.
- Y221 (≠ W213) mutation to A: Abolishes interaction with MIAC; when associated with A-217.
Sites not aligning to the query:
- 229 S→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; S→D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 231 S→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; S→D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 232 E→A: Reduces interaction with MIAC.
- 244 T→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; T→E: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 254 R → L: in NDI2; results in the loss of arginine vasopressin-mediated phosphorylation at S-256; R → Q: in NDI2; exerts a dominant-negative effect on wild-type-AQP2 in that it interferes with its trafficking to the apical membrane; is a loss of function instead of a gain of function mutation on dominant nephrogenic diabetes insipidus
- 256 modified: Phosphoserine; by PKA; S→A: Retained in vesicles.; S→D: Expressed in the apical membrane.
- 258 E → K: in NDI2; retained in the Golgi compartment; dbSNP:rs104894332
- 262 P → L: in NDI2; mutant protein folds properly and is functional but is retained in intracellular vesicles; able to assemble into tetramers with wild-type AQP2 that properly localize to the apical membrane; dbSNP:rs104894339; P→A: No effect on expression at the apical cell membrane.
P23645 Neurogenic protein big brain from Drosophila melanogaster (Fruit fly) (see 3 papers)
30% identity, 80% coverage: 40:215/221 of query aligns to 99:277/696 of P23645
- D253 (≠ H191) mutation to N: No effect on transport activity.
- E274 (≠ T212) mutation to Q: No effect on transport activity.
Sites not aligning to the query:
- 46 modified: Phosphoserine
- 47 modified: Phosphothreonine
- 71 E→D: Partial loss of transport activity and increased sensitivity to blocking by the magnesium ion.; E→K: Loss of expression in cell membrane.; E→N: Loss of transport activity.; E→Q: Loss of transport activity.
- 300 modified: Phosphoserine
- 394 modified: Phosphoserine
- 576 modified: Phosphoserine
4nefA X-ray structure of human aquaporin 2 (see paper)
28% identity, 97% coverage: 1:215/221 of query aligns to 6:222/239 of 4nefA
Q39196 Probable aquaporin PIP1-4; Plasma membrane intrinsic protein 1-4; AtPIP1;4; Transmembrane protein C; TMP-C from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 97% coverage: 2:216/221 of query aligns to 50:279/287 of Q39196
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 70% coverage: 2:156/221 of query aligns to 49:217/286 of Q08733
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
P55088 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 77% coverage: 5:174/221 of query aligns to 36:215/323 of P55088
- S111 (≠ D81) modified: Phosphoserine; by PKG; mutation to A: Loss of phosphorylation by PKG (in vitro). No effect on location at cell membrane.
Sites not aligning to the query:
- 4 natural variant: G -> R
P47863 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 77% coverage: 5:174/221 of query aligns to 36:215/323 of P47863
- S180 (≠ G143) modified: Phosphoserine; by PKC; mutation to A: Decreases internalization from the cell membrane in response to PKC activation.
- H201 (≠ Y162) mutation to P: Partial loss of transport activity.
Sites not aligning to the query:
- 13 modified: S-palmitoyl cysteine; C→A: Reduced palmitoylation. Loss of palmitoylation; when associated with A-17.
- 17 modified: S-palmitoyl cysteine; C→A: Reduced palmitoylation. Loss of palmitoylation; when associated with A-13.
- 285 modified: Phosphoserine
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 62% coverage: 1:136/221 of query aligns to 76:209/305 of Q9SAI4
- A119 (≠ T47) mutation to W: 6-fold increase in water transport activity, but impaired in urea transport.
Sites not aligning to the query:
- 252 V→A: No effect.
5dyeD Crystal structure of the full length s156e mutant of human aquaporin 5 (see paper)
37% identity, 45% coverage: 1:99/221 of query aligns to 7:100/253 of 5dyeD
Sites not aligning to the query:
P55064 Aquaporin-5; AQP-5 from Homo sapiens (Human) (see 2 papers)
37% identity, 45% coverage: 1:99/221 of query aligns to 8:101/265 of P55064
- A38 (≠ D36) to E: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123054
- I45 (≠ N43) to S: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123055
Sites not aligning to the query:
- 123 N → D: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123057
- 156 S→A: No effect on location at the cell membrane.; S→E: Increased location at the cell membrane.
- 177 I → F: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123056
- 188 R → C: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs368292687
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
27% identity, 52% coverage: 5:119/221 of query aligns to 59:171/306 of I1CR68
Sites not aligning to the query:
- 275 H→A: Affects pH sensing; when associated with A-85.
Q54WT8 Aquaporin-B from Dictyostelium discoideum (Social amoeba) (see paper)
31% identity, 48% coverage: 3:107/221 of query aligns to 45:146/294 of Q54WT8
- S75 (≠ N35) modified: carbohydrate, O-linked (GalNAc...) serine
- S120 (≠ D81) mutation to A: Permanently unphosphorylated state, impermeable to water in Xenopus oocytes.; mutation to D: Permanently phosphorylated, impermeable to water in Xenopus oocytes.
Sites not aligning to the query:
- 208:212 mutation Missing: Impermeable to water in Xenopus oocytes.
- 208:219 Required for water permeability; mutation Missing: Permeable to water in Xenopus oocytes and liposomes, impermeable to glycerol and urea.
- 239 Selectivity filter
- 275 D→A: Impermeable to water in Xenopus oocytes.; D→P: Impermeable to water in Xenopus oocytes.
Query Sequence
>Ga0059261_3272 FitnessBrowser__Korea:Ga0059261_3272
VTLARRVIAEFTGTAMLLAIVVGSGIMGERLSGGNDAIALLGNTLATGAGLIVLIQMFGP
ISGAHFNPAVTLTLLLKRESDARTAALYAAAQFAGAILGVWVAHAMFAEPVLQLSAKARD
GLPQGLAEAVATFGLIGTILCTGRHRPDATPVAVGLYITAAYWFTSSTSFANPAVTVART
LSDSFAGIAPHSAPLFVAGQLAGAIAALLFFTWLLREERPQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory