Comparing Ga0059261_3653 FitnessBrowser__Korea:Ga0059261_3653 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
59% identity, 91% coverage: 27:276/276 of query aligns to 9:257/257 of P0AAH0
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
37% identity, 87% coverage: 32:271/276 of query aligns to 6:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
35% identity, 86% coverage: 38:275/276 of query aligns to 13:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
35% identity, 86% coverage: 38:275/276 of query aligns to 13:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
35% identity, 86% coverage: 38:275/276 of query aligns to 13:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
35% identity, 86% coverage: 38:275/276 of query aligns to 13:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 85% coverage: 38:272/276 of query aligns to 11:237/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 84% coverage: 39:271/276 of query aligns to 37:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 84% coverage: 39:271/276 of query aligns to 37:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
32% identity, 83% coverage: 39:268/276 of query aligns to 37:260/260 of 7ahdC
Sites not aligning to the query:
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
35% identity, 86% coverage: 38:273/276 of query aligns to 12:251/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 86% coverage: 38:273/276 of query aligns to 16:255/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 83% coverage: 42:271/276 of query aligns to 19:241/343 of P30750
Sites not aligning to the query:
4f4cA The crystal structure of the multi-drug transporter (see paper)
31% identity, 88% coverage: 17:260/276 of query aligns to 1009:1248/1250 of 4f4cA
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 83% coverage: 42:271/276 of query aligns to 20:242/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 83% coverage: 42:271/276 of query aligns to 20:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 83% coverage: 42:271/276 of query aligns to 20:242/344 of 3tuiC
Sites not aligning to the query:
4ayxA Structure of the human mitochondrial abc transporter, abcb10 (rod form b) (see paper)
31% identity, 89% coverage: 18:262/276 of query aligns to 347:569/571 of 4ayxA
Sites not aligning to the query:
4q9iA P-glycoprotein cocrystallised with qz-ala (see paper)
38% identity, 66% coverage: 44:226/276 of query aligns to 955:1132/1184 of 4q9iA
Sites not aligning to the query:
4m1mA Corrected structure of mouse p-glycoprotein (see paper)
38% identity, 66% coverage: 44:226/276 of query aligns to 966:1143/1188 of 4m1mA
Sites not aligning to the query:
>Ga0059261_3653 FitnessBrowser__Korea:Ga0059261_3653
MTSVMTQTDLADSADTSAAPARPAEHAKMAARGVNVFYGEKQAIRDVSIDVDMENVTAFI
GPSGCGKSTFLRTLNRMNDTVASARVEGEITLDGENIYDKSMDVVQLRARVGMVFQKPNP
FPKSIYENVAYGPRIHGLARAKGDMDQIVERSLKRAGLWEEVKDRLNDSGTALSGGQQQR
LCIARAIAVDPEVILMDEPCSALDPIATAKIEELIHELRGRYAIVIVTHNMQQAARVSQR
TAFFHLGTLVEYGETDQIFTAPRQERTKDYITGRYG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory