Comparing Ga0059261_4138 FitnessBrowser__Korea:Ga0059261_4138 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6xycA Truncated form of carbohydrate esterase from gut microbiota (see paper)
30% identity, 87% coverage: 34:288/292 of query aligns to 10:282/285 of 6xycA
6nkfA Crystal structure of the lipase lip_vut4 from goat rumen metagenome.
32% identity, 83% coverage: 47:288/292 of query aligns to 42:291/301 of 6nkfA
Sites not aligning to the query:
5aocA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound (see paper)
29% identity, 82% coverage: 30:267/292 of query aligns to 9:244/277 of 5aocA
5aobA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound (see paper)
29% identity, 82% coverage: 30:267/292 of query aligns to 5:245/278 of 5aobA
7bfrA Thermogutta terrifontis esterase 2 phosphorylated by paraoxon (see paper)
29% identity, 83% coverage: 30:270/292 of query aligns to 5:231/260 of 7bfrA
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
42% identity, 36% coverage: 49:154/292 of query aligns to 59:166/309 of 1qz3A
Sites not aligning to the query:
Q5ATJ7 Non-reducing polyketide synthase ausA; Austinoid biosynthesis clusters protein A; Methylorcinaldehyde synthase ausA; EC 2.3.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
24% identity, 90% coverage: 26:288/292 of query aligns to 2122:2473/2476 of Q5ATJ7
Sites not aligning to the query:
4v2iA Biochemical characterization and structural analysis of a new cold- active and salt tolerant esterase from the marine bacterium thalassospira sp (see paper)
33% identity, 40% coverage: 37:154/292 of query aligns to 50:169/315 of 4v2iA
Sites not aligning to the query:
4n5iX Crystal structure of a c8-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
25% identity, 79% coverage: 16:246/292 of query aligns to 3:250/311 of 4n5iX
Sites not aligning to the query:
P95125 Carboxylic ester hydrolase LipN; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 38% coverage: 45:154/292 of query aligns to 117:228/376 of P95125
Sites not aligning to the query:
4oukX Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
28% identity, 50% coverage: 16:160/292 of query aligns to 3:160/309 of 4oukX
Sites not aligning to the query:
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
28% identity, 50% coverage: 16:160/292 of query aligns to 6:163/309 of 4po3X
Sites not aligning to the query:
4ob6A Complex structure of esterase rppe s159a/w187h and substrate (s)-ac- cpa (see paper)
35% identity, 36% coverage: 49:153/292 of query aligns to 65:171/319 of 4ob6A
Sites not aligning to the query:
6sylA Structure of ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of butyl 4-nitrophenyl hexylphosphonate (see paper)
28% identity, 42% coverage: 41:162/292 of query aligns to 73:205/339 of 6sylA
Sites not aligning to the query:
8pc7A Structure of ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of bipyridine phosphonate (see paper)
28% identity, 42% coverage: 41:162/292 of query aligns to 70:202/336 of 8pc7A
Sites not aligning to the query:
6syaA Structure of s192a-ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with methyl (2r)-2-phenylpropanoate (see paper)
27% identity, 42% coverage: 41:162/292 of query aligns to 73:205/339 of 6syaA
Sites not aligning to the query:
6sxyB Structure of s192a-ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with methyl (2s)-2-phenylpropanoate (see paper)
27% identity, 42% coverage: 41:162/292 of query aligns to 73:205/340 of 6sxyB
Sites not aligning to the query:
F1DBA9 Non-reducing polyketide synthase mapC; Mycophenolic acid biosynthesis cluster protein C; EC 2.3.1.- from Penicillium brevicompactum (see paper)
29% identity, 59% coverage: 12:182/292 of query aligns to 2083:2259/2448 of F1DBA9
Sites not aligning to the query:
P13676 Acylamino-acid-releasing enzyme; AARE; Acyl-peptide hydrolase; APH; Acylaminoacyl-peptidase; EC 3.4.19.1 from Rattus norvegicus (Rat) (see paper)
26% identity, 86% coverage: 38:288/292 of query aligns to 476:729/732 of P13676
Sites not aligning to the query:
2o7rA Plant carboxylesterase aecxe1 from actinidia eriantha with acyl adduct (see paper)
31% identity, 45% coverage: 22:153/292 of query aligns to 16:163/307 of 2o7rA
Sites not aligning to the query:
>Ga0059261_4138 FitnessBrowser__Korea:Ga0059261_4138
MRHMAKRSGLAALALMLAMPATSPAQTPAPAQVTSSTDVIYATHPTGPLHLDLHRPAGKG
RAPVLVVLHGGGWARGERPKSWAGLRPFVEAGYAIVSVQYRLSGTAQAPAAVQDARCAMA
WVARNADRHQLDPRRLVVLGTSAGGHLALMAGMLGGRADIDLPACGPVPRAAAIIDFYGP
TDLRPESLGKWRSPSVTKWIGEGPDAPALAERMSPLTLVRKGQVPVFIVHGDADNVVPIQ
SSRQLKAALDRAGVPSELHIVPGGGHGKLGEEAQARLYADALRFLERHRITR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory