Comparing H281DRAFT_00987 FitnessBrowser__Burk376:H281DRAFT_00987 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
43% identity, 90% coverage: 38:421/429 of query aligns to 3:378/382 of 7ahhC
7aheC Opua inhibited inward facing (see paper)
43% identity, 90% coverage: 38:421/429 of query aligns to 3:378/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
55% identity, 60% coverage: 38:295/429 of query aligns to 3:260/260 of 7ahdC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
41% identity, 54% coverage: 67:297/429 of query aligns to 12:242/375 of 2d62A
1g291 Malk (see paper)
38% identity, 54% coverage: 66:297/429 of query aligns to 8:239/372 of 1g291
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 55% coverage: 66:300/429 of query aligns to 9:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 55% coverage: 66:300/429 of query aligns to 10:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 55% coverage: 66:300/429 of query aligns to 10:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 55% coverage: 66:300/429 of query aligns to 10:244/344 of 3tuiC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
38% identity, 55% coverage: 65:301/429 of query aligns to 5:239/240 of 4ymuJ
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 59% coverage: 76:330/429 of query aligns to 15:262/348 of 3d31A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 52% coverage: 80:303/429 of query aligns to 36:253/378 of P69874
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
38% identity, 53% coverage: 72:298/429 of query aligns to 15:240/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
38% identity, 53% coverage: 72:298/429 of query aligns to 15:240/263 of 7d08B
Sites not aligning to the query:
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
38% identity, 53% coverage: 72:298/429 of query aligns to 13:238/253 of 6z5uK
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
38% identity, 53% coverage: 72:297/429 of query aligns to 17:228/353 of 1vciA
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
40% identity, 52% coverage: 76:297/429 of query aligns to 18:233/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
40% identity, 52% coverage: 76:297/429 of query aligns to 18:233/362 of 8hprD
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
39% identity, 52% coverage: 76:298/429 of query aligns to 16:232/384 of 8hplC
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 52% coverage: 76:297/429 of query aligns to 19:234/393 of P9WQI3
>H281DRAFT_00987 FitnessBrowser__Burk376:H281DRAFT_00987
MTPNLTFAPDSMVHPGTFGADDVSAAAKPVAISGTDILTVKNLSKIFGPRPERAAELIRQ
GLGRNEIFEQTGNMVAVNDVSLSVKAGEIFVVMGLSGSGKSTLVRLLNRLIEPTSGQVIL
EGRDIAPMSTPELRDVRRKKMAMVFQSFALLPNRTVLDNIAYGLEVAGLKKAERYDIARA
ALTRVGLGSYEKLLPGELSGGMQQRVGLARALAVNPSVLLMDEAFSALDPLIRFEMQSEL
LRLQKEEQRTIVFISHDIEEAIKIGGRIGIMKDGCLIQVGTPAELIQSPADDYVRDFFRN
VDVSRFLKASSLMTRVERELISCDVAAPSERYLNQLIDSGADCGYVCDEAGRYQGCVTPA
SLRKTGAHSIREAFVNDVNAVPLDADLHQLATIALNQQHDVPVTDTAGRLAGIVSCRAIL
KQVMERRAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory