Comparing H281DRAFT_01929 FitnessBrowser__Burk376:H281DRAFT_01929 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
32% identity, 64% coverage: 59:168/171 of query aligns to 538:648/650 of O31645
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
29% identity, 84% coverage: 26:168/171 of query aligns to 2:141/143 of C0H3V2
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 81% coverage: 28:165/171 of query aligns to 496:633/637 of P00550
Sites not aligning to the query:
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
27% identity, 91% coverage: 3:158/171 of query aligns to 493:638/648 of O31644
Sites not aligning to the query:
8gvhA Human ae2 in acidic kno3 (see paper)
32% identity, 49% coverage: 80:162/171 of query aligns to 129:213/788 of 8gvhA
Sites not aligning to the query:
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
26% identity, 81% coverage: 28:165/171 of query aligns to 4:141/144 of 1j6tA
>H281DRAFT_01929 FitnessBrowser__Burk376:H281DRAFT_01929
MERQSIAPARRTQATFSPVNMNRLAKFLPLENVVVGLSVTSKKRVFEQAGLIFENQNGIA
RSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKQPLAAFVRLAEPIPFESPDGQPVSLL
IFLLVPEQATQQHLEILSEIAQLLSDREARERLHTEEDRESLHRLLTQWQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory