Comparing H281DRAFT_02117 FitnessBrowser__Burk376:H281DRAFT_02117 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
29% identity, 92% coverage: 29:422/427 of query aligns to 13:405/413 of P32140
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
29% identity, 92% coverage: 29:422/427 of query aligns to 25:417/425 of 7ag4D
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
29% identity, 92% coverage: 29:422/427 of query aligns to 13:405/416 of 2zblA
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
24% identity, 88% coverage: 36:409/427 of query aligns to 22:414/423 of 8h1lB
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
25% identity, 92% coverage: 15:408/427 of query aligns to 3:397/410 of 3wkhA
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
25% identity, 92% coverage: 15:408/427 of query aligns to 3:397/410 of 3wkgA
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
25% identity, 92% coverage: 15:408/427 of query aligns to 3:397/407 of 3wkiA
P0DKY4 Cellobiose 2-epimerase; CE; EC 5.1.3.11 from Ruminococcus albus (see paper)
21% identity, 86% coverage: 45:412/427 of query aligns to 24:387/389 of P0DKY4
7d5gA Crystal structure of the csce with ligand to have a insight into the catalytic mechanism
22% identity, 91% coverage: 23:411/427 of query aligns to 5:389/389 of 7d5gA
8wbvA The crystal structure of linear mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
22% identity, 91% coverage: 23:411/427 of query aligns to 7:391/391 of 8wbvA
8wbuA The crystal structure of circular mannose with mutant h247f of the cellobiose 2-epimerase from caldicellulosiruptor saccharolyticus
22% identity, 91% coverage: 23:411/427 of query aligns to 7:391/391 of 8wbuA
>H281DRAFT_02117 FitnessBrowser__Burk376:H281DRAFT_02117
MTLSATPPSANGAPVVPAVASFRSREFLLSHVEDTLRFYAPNVFDSSGGFFHFFRDDGSV
YDKTTRHLVSSCRYVFNYAMAYRQFGDPKHLEYARHGLQFLRDAHWDGQHEGYDWEIEWS
DGRKRTLDATRHCYGLAFVLLAYSHAAMAGIEEAKPMIGATFELMEHRFWDAAAGLYADE
ASPEWRVSSYRGQNANMHTTEALLAAHEATGHLVYLDRAERVASNITLRQAKLSQGLVWE
HFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLILERYRPLPWLLPRAIELFDA
AMTHAWDEDHGGLYYGFGPDGTVCDHDKYFWVQAETFATAALLGKRTGNERFWDWYDEIW
RYSWAHFVDHKYGAWYRILTCDNRKYSDEKSPAGKTDYHTMGACYEVLTHALADGSTAAA
VSTEHAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory