Comparing H281DRAFT_02118 FitnessBrowser__Burk376:H281DRAFT_02118 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 90% coverage: 15:286/303 of query aligns to 11:283/319 of Q8ZKR2
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
33% identity, 90% coverage: 15:286/303 of query aligns to 7:272/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
33% identity, 90% coverage: 15:286/303 of query aligns to 7:272/297 of 1tz6A
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
31% identity, 92% coverage: 16:294/303 of query aligns to 17:307/312 of 4wjmA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
31% identity, 91% coverage: 15:291/303 of query aligns to 8:291/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 91% coverage: 15:291/303 of query aligns to 12:295/310 of 5yggA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 89% coverage: 34:303/303 of query aligns to 33:301/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 89% coverage: 34:303/303 of query aligns to 33:301/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
31% identity, 89% coverage: 34:302/303 of query aligns to 33:300/300 of 1v1bA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
25% identity, 95% coverage: 13:300/303 of query aligns to 5:294/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
25% identity, 95% coverage: 13:300/303 of query aligns to 4:293/302 of 3gbuA
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
31% identity, 91% coverage: 29:303/303 of query aligns to 24:317/322 of 3lkiB
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 91% coverage: 29:303/303 of query aligns to 31:298/300 of 8cqxA
7fcaD Pfkb(mycobacterium marinum) (see paper)
37% identity, 45% coverage: 129:263/303 of query aligns to 107:240/282 of 7fcaD
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
25% identity, 92% coverage: 13:290/303 of query aligns to 6:290/308 of 3iq0B
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
27% identity, 88% coverage: 32:298/303 of query aligns to 36:299/309 of 3uqdB
Sites not aligning to the query:
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
27% identity, 88% coverage: 32:298/303 of query aligns to 36:299/309 of 3uqdA
Sites not aligning to the query:
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
27% identity, 88% coverage: 32:298/303 of query aligns to 36:299/309 of 3n1cA
Sites not aligning to the query:
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 88% coverage: 32:298/303 of query aligns to 36:299/309 of P06999
Sites not aligning to the query:
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
27% identity, 85% coverage: 32:288/303 of query aligns to 36:292/304 of 3cqdA
Sites not aligning to the query:
>H281DRAFT_02118 FitnessBrowser__Burk376:H281DRAFT_02118
MSHVSNELPVFVSAGDILTDLVRTGASQWLSRPGGAGWNVARCVARLGLPTACAGSLGVD
NFSDELWDASVAAGLDMRFMQRVERPPLLAIVHRTHPPAYFFMGENGADLAFDPAHLPAG
WMQQVKWAHFGCISLVRQPLGDTLAALAAELRSRGVKISFDPNYRNLMEHGYEPTLRKMA
ALADLIKVSDEDLRLLFKTDDEAHALAQLRAMNPAATVLVTRGPETAVLIDGAATFEARP
PRVEVVDTVGAGDASIGGLLFSLMTASQRAWPEHLAFALAAGAAACRHAGAHAPSLDEVV
ALL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory