Comparing H281DRAFT_02672 FitnessBrowser__Burk376:H281DRAFT_02672 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
29% identity, 94% coverage: 13:261/264 of query aligns to 14:261/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 97% coverage: 6:260/264 of query aligns to 3:264/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 97% coverage: 6:260/264 of query aligns to 3:258/262 of 6eb3C
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 94% coverage: 14:262/264 of query aligns to 17:270/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 94% coverage: 14:262/264 of query aligns to 17:270/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 94% coverage: 14:262/264 of query aligns to 17:270/278 of 4uhfA
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 97% coverage: 6:260/264 of query aligns to 3:261/265 of 6eb3A
5frdA Structure of a thermophilic esterase (see paper)
24% identity, 100% coverage: 1:263/264 of query aligns to 1:250/256 of 5frdA
7c4dA Marine microorganism esterase (see paper)
24% identity, 92% coverage: 16:259/264 of query aligns to 6:261/261 of 7c4dA
Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase; HOPDA; EC 3.7.1.13 from Pseudomonas resinovorans (see paper)
26% identity, 99% coverage: 2:263/264 of query aligns to 12:283/290 of Q9AQM4
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
27% identity, 93% coverage: 14:259/264 of query aligns to 52:304/310 of 6i8wB
Sites not aligning to the query:
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
23% identity, 97% coverage: 5:261/264 of query aligns to 3:268/269 of 5h3hB
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
27% identity, 98% coverage: 3:262/264 of query aligns to 6:276/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
27% identity, 98% coverage: 3:262/264 of query aligns to 6:276/276 of 4lxiA
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
27% identity, 98% coverage: 3:262/264 of query aligns to 6:276/276 of 4lxhA
1hl7A Gamma lactamase from an aureobacterium species in complex with 3a,4,7, 7a-tetrahydro-benzo [1,3] dioxol-2-one (see paper)
28% identity, 87% coverage: 13:241/264 of query aligns to 14:259/279 of 1hl7A
5z7wB Crystal structure of striga hermonthica htl1 (shhtl1) (see paper)
25% identity, 79% coverage: 20:228/264 of query aligns to 16:234/271 of 5z7wB
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
24% identity, 84% coverage: 19:241/264 of query aligns to 14:247/269 of O07015
7a7gA Soluble epoxide hydrolase in complex with tk90 (see paper)
24% identity, 93% coverage: 1:246/264 of query aligns to 9:299/317 of 7a7gA
7p4kA Soluble epoxide hydrolase in complex with fl217 (see paper)
24% identity, 93% coverage: 1:246/264 of query aligns to 9:295/313 of 7p4kA
>H281DRAFT_02672 FitnessBrowser__Burk376:H281DRAFT_02672
MSQSTFCEIPAGRIAYSRRGTGRPLVLLHPIGVDRSWWDEYVEHWAASYDVVAIDLRGHG
ESSVITSPVTLADHAADVAAVLRKEHLSGATLIGVSMGGMIAQRVAIQFPELAGALILCG
TAGGFPDEVRPRILARGDMSRQGSMSEVTDDTIARWFTADTPRPDLVEKCRARLAADDWY
SWSANWQAISQLDNLGELPRVKAPALVVAGEADASIAPAVSQKIADALPHSRFVVVPGAA
HFGAFDMREVFATVFDDFLSSLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory