Comparing H281DRAFT_02705 FitnessBrowser__Burk376:H281DRAFT_02705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
45% identity, 78% coverage: 66:348/365 of query aligns to 3:273/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
38% identity, 81% coverage: 56:349/365 of query aligns to 1:280/284 of 7e7mC
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
37% identity, 78% coverage: 63:345/365 of query aligns to 1:270/271 of 1dbpA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
39% identity, 68% coverage: 66:312/365 of query aligns to 5:237/270 of 4zjpA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
34% identity, 75% coverage: 63:334/365 of query aligns to 2:270/287 of 5dteB
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
30% identity, 79% coverage: 63:349/365 of query aligns to 1:284/292 of 2fn8A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
32% identity, 75% coverage: 70:344/365 of query aligns to 8:282/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
32% identity, 75% coverage: 70:344/365 of query aligns to 8:282/288 of 1gudA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 82% coverage: 52:349/365 of query aligns to 25:308/349 of A0QYB5
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
31% identity, 72% coverage: 85:347/365 of query aligns to 24:282/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
31% identity, 72% coverage: 85:347/365 of query aligns to 23:281/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
31% identity, 72% coverage: 85:347/365 of query aligns to 23:281/304 of 6hbmA
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
32% identity, 78% coverage: 64:349/365 of query aligns to 3:276/315 of 4rsmA
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
31% identity, 68% coverage: 100:347/365 of query aligns to 38:275/301 of 2x7xA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
31% identity, 70% coverage: 70:325/365 of query aligns to 8:262/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
31% identity, 70% coverage: 70:325/365 of query aligns to 8:262/288 of 8wl9A
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 78% coverage: 65:349/365 of query aligns to 36:308/349 of A0QYB3
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
31% identity, 78% coverage: 65:349/365 of query aligns to 3:275/315 of 4rs3A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
31% identity, 78% coverage: 65:349/365 of query aligns to 3:275/314 of 5hkoA
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
31% identity, 68% coverage: 64:312/365 of query aligns to 1:245/302 of 5ocpA
>H281DRAFT_02705 FitnessBrowser__Burk376:H281DRAFT_02705
MAWSSARFDGWDVLGKPTCAVLLCAAAALAGCSKSDNSSTSTTSGQAASAPASAPVANAS
GGKTKVGFSVSTLNNAFFVGLKAGVEKGAKEQGFDLVQTNANGDAQQQVNDAINLLSQGV
TALVLNPIDSKAIIPAVEKANSMNIPVFMLDRGSDGGKVTSFVASDNVALGQTAAKWIAD
QLTKRYGSAKGNVVDLIGLVGTTAATDREKGFSDEIAKYPDIKVVARQEGAFDQEKSLNA
MTNILQKYPQIDAVFGANDDNTVGAEKAIDNAGRYKPLGDKQHILVIGADGTAQALSAIR
AGKQDATISQNPIQMAAKSLQFVADYSAKKEVPANYAWPTLLIDKSNIDSDATKKYGLWS
EEVKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory