SitesBLAST
Comparing H281DRAFT_02718 FitnessBrowser__Burk376:H281DRAFT_02718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
30% identity, 90% coverage: 36:454/466 of query aligns to 24:445/447 of 5fjnA
- active site: S67 (= S79), Y71 (≠ W83), S72 (≠ G84), L252 (≠ G259)
- binding 2-aminobenzoic acid: L252 (≠ G259), R289 (≠ G296), V411 (≠ G420), W412 (≠ H421)
- binding flavin-adenine dinucleotide: I34 (= I46), G35 (= G47), G37 (= G49), I38 (= I50), Q39 (≠ V51), L57 (= L69), E58 (= E70), K59 (= K71), E65 (= E77), Q66 (= Q78), S67 (= S79), A70 (≠ N82), Y71 (≠ W83), S72 (≠ G84), Q73 (≠ W85), V201 (= V208), G230 (= G237), G231 (= G238), W233 (= W240), L252 (≠ G259), Q254 (≠ A261), F343 (= F351), V385 (≠ I393), T410 (≠ S419), V411 (≠ G420), W412 (≠ H421), G413 (= G422), M414 (≠ F423), T415 (≠ G424)
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
30% identity, 90% coverage: 36:454/466 of query aligns to 24:445/447 of 5fjmA
- active site: S67 (= S79), Y71 (≠ W83), S72 (≠ G84), L252 (≠ G259)
- binding flavin-adenine dinucleotide: I34 (= I46), G35 (= G47), G37 (= G49), I38 (= I50), Q39 (≠ V51), L57 (= L69), E58 (= E70), K59 (= K71), E65 (= E77), Q66 (= Q78), S67 (= S79), A70 (≠ N82), Y71 (≠ W83), S72 (≠ G84), Q73 (≠ W85), V201 (= V208), G230 (= G237), G231 (= G238), W233 (= W240), L252 (≠ G259), Q254 (≠ A261), F343 (= F351), V385 (≠ I393), T410 (≠ S419), V411 (≠ G420), W412 (≠ H421), G413 (= G422), M414 (≠ F423), T415 (≠ G424)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
29% identity, 90% coverage: 36:454/466 of query aligns to 12:433/433 of 5hxwA
- active site: F58 (≠ N82), Q61 (≠ W85), A62 (≠ V86), Q240 (≠ G259), V284 (vs. gap), F288 (≠ P307)
- binding cetyl-trimethyl-ammonium: G291 (≠ S310), Y294 (≠ F313), N310 (≠ K326), E311 (≠ V327), F317 (= F333), M318 (≠ F334), S320 (≠ N340), M373 (≠ I393), E379 (≠ L399), G399 (= G420), W400 (≠ H421)
- binding flavin-adenine dinucleotide: V22 (≠ I46), G23 (= G47), G25 (= G49), I26 (= I50), L27 (≠ V51), E46 (= E70), K47 (= K71), E53 (= E77), Q54 (= Q78), S55 (= S79), R57 (= R81), F58 (≠ N82), Y59 (≠ W83), G60 (= G84), Q61 (≠ W85), A188 (= A207), A189 (≠ V208), G218 (= G237), G219 (= G238), W221 (= W240), Q240 (≠ G259), Q242 (≠ A261), F331 (= F351), G371 (= G391), M373 (≠ I393), T398 (≠ S419), G399 (= G420), W400 (≠ H421), G401 (= G422), M402 (≠ F423), T403 (≠ G424)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
28% identity, 90% coverage: 36:454/466 of query aligns to 20:383/383 of 5i39A
- active site: F66 (≠ N82), Q69 (≠ W85), A70 (≠ V86), Q248 (≠ E266), P267 (= P295)
- binding flavin-adenine dinucleotide: V30 (≠ I46), G31 (= G47), G33 (= G49), I34 (= I50), L35 (≠ V51), V53 (≠ L69), E54 (= E70), K55 (= K71), Q62 (= Q78), S63 (= S79), F66 (≠ N82), Y67 (≠ W83), Q69 (≠ W85), A196 (= A207), A197 (≠ V208), G226 (= G237), G227 (= G238), W229 (= W240), Q248 (≠ E266), Q250 (≠ P268), G321 (= G391), M323 (≠ I393), T348 (≠ S419), G349 (= G420), W350 (≠ H421), G351 (= G422), M352 (≠ F423), T353 (≠ G424)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 88% coverage: 39:446/466 of query aligns to 41:417/857 of Q63342
- CV 52:53 (≠ IV 50:51) binding
- EK 73:74 (= EK 70:71) binding
- 80:88 (vs. 77:85, 11% identical) binding
- H84 (≠ R81) modified: Tele-8alpha-FAD histidine
- V212 (= V208) binding
- W244 (= W240) binding
- F-GYGII 390:395 (≠ FSGHGFG 418:424) binding
Sites not aligning to the query:
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
25% identity, 88% coverage: 39:446/466 of query aligns to 4:380/824 of 4pabB
- active site: T53 (≠ R87), E102 (≠ Q136), H226 (≠ G259), Y255 (= Y297)
- binding flavin-adenine dinucleotide: I11 (= I46), G12 (= G47), G14 (= G49), C15 (≠ I50), V16 (= V51), L35 (= L69), E36 (= E70), K37 (= K71), G43 (≠ E77), S44 (≠ Q78), T45 (≠ S79), H47 (≠ R81), A48 (≠ N82), A49 (≠ W83), G50 (= G84), L51 (≠ W85), V175 (= V208), A204 (≠ G237), G205 (= G238), W207 (= W240), H226 (≠ G259), Y228 (≠ A261), G326 (= G391), I328 (= I393), F353 (= F418), Y355 (≠ H421), G356 (= G422), I357 (≠ F423), I358 (≠ G424)
Sites not aligning to the query:
- active site: 536
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 91% coverage: 32:455/466 of query aligns to 17:401/824 of Q8GAI3
- W66 (≠ G80) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R81) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
23% identity, 88% coverage: 39:446/466 of query aligns to 48:424/866 of Q9UI17
- CV 59:60 (≠ IV 50:51) binding
- EK 80:81 (= EK 70:71) binding
- 87:95 (vs. 77:85, 11% identical) binding
- H91 (≠ R81) modified: Tele-8alpha-FAD histidine
- H109 (≠ A99) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V208) binding
- S279 (≠ V271) to P: in dbSNP:rs532964
- F-GYGII 397:402 (≠ FSGHGFG 418:424) binding
Sites not aligning to the query:
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
30% identity, 45% coverage: 42:253/466 of query aligns to 21:240/403 of 2gagB
- active site: A61 (≠ G80), T64 (≠ W83), T65 (≠ G84)
- binding flavin-adenine dinucleotide: G26 (= G47), G28 (= G49), G29 (≠ I50), H30 (≠ V51), E51 (= E70), K52 (= K71), G58 (≠ E77), N59 (≠ Q78), M60 (≠ S79), R62 (= R81), N63 (= N82), T64 (≠ W83), I66 (≠ W85), V195 (= V208), G224 (= G237), A225 (≠ G238), H227 (≠ W240), L231 (≠ F244)
- binding flavin mononucleotide: A61 (≠ G80), R62 (= R81), H171 (≠ P184)
- binding 2-furoic acid: T64 (≠ W83), I66 (≠ W85), R68 (= R87)
- binding sulfite ion: K170 (≠ E183)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 246, 352, 353, 354, 355, 356, 357
- binding flavin mononucleotide: 250, 278, 321, 323
- binding 2-furoic acid: 263, 270, 357, 401
- binding sulfite ion: 276
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
29% identity, 46% coverage: 37:250/466 of query aligns to 1:213/374 of 1y56B
- active site: F44 (≠ G80), G47 (≠ W83), T48 (≠ G84)
- binding flavin-adenine dinucleotide: G11 (= G47), G13 (= G49), I14 (= I50), V15 (= V51), I33 (≠ L69), E34 (= E70), K35 (= K71), S42 (≠ Q78), T43 (≠ S79), R45 (= R81), C46 (≠ N82), G47 (≠ W83), G49 (≠ W85), E170 (≠ A207), V171 (= V208), T200 (≠ G237), N201 (≠ G238), W203 (= W240)
- binding flavin mononucleotide: F44 (≠ G80), R45 (= R81)
Sites not aligning to the query:
- active site: 224, 239, 305, 338
- binding flavin-adenine dinucleotide: 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
27% identity, 45% coverage: 40:247/466 of query aligns to 1:210/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I46), G8 (= G47), G10 (= G49), V11 (≠ I50), I12 (≠ V51), V30 (≠ L69), E31 (= E70), K32 (= K71), E38 (= E77), A39 (≠ Q78), S40 (= S79), A43 (≠ N82), G45 (= G84), L46 (≠ W85), V171 (= V208), G200 (= G237), G201 (= G238), W203 (= W240)
Sites not aligning to the query:
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
29% identity, 43% coverage: 53:253/466 of query aligns to 34:242/405 of P40875
- C146 (≠ I163) mutation to S: No change in activity.
- H173 (≠ P184) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ K186) mutation to A: No effect on FMN binding and activity.
- C195 (= C206) mutation to S: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 351 C→A: No change in activity.
2gb0B Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/389 of 2gb0B
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), S200 (≠ A236), M201 (≠ G237), G202 (= G238), W204 (= W240)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
3qseA Crystal structure for the complex of substrate-reduced msox with sarcosine (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 3qseA
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), V173 (= V208), M201 (≠ G237), G202 (= G238), W204 (= W240)
- binding sarcosine: I50 (≠ Q88), R52 (≠ N90)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding chloride ion: 317, 342
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding sarcosine: 245, 254, 269, 344, 345, 348
2gf3A Structure of the complex of monomeric sarcosine with its substrate analogue inhibitor 2-furoic acid at 1.3 a resolution.
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 2gf3A
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), G42 (= G80), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), M201 (≠ G237), G202 (= G238), W204 (= W240)
- binding 2-furoic acid: I50 (≠ Q88), R52 (≠ N90), P217 (= P253)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding 2-furoic acid: 219, 221, 245, 254, 319, 320, 321, 345, 348
2a89A Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 2a89A
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding (n5,c4a)-(alpha-hydroxy-propano)-3,4,4a,5-tetrahydro-flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), G42 (= G80), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), M201 (≠ G237), G202 (= G238), W204 (= W240)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding (n5,c4a)-(alpha-hydroxy-propano)-3,4,4a,5-tetrahydro-flavin-adenine dinucleotide: 254, 256, 315, 316, 317, 344, 345, 346, 347, 348
1eliA Complex of monomeric sarcosine oxidase with the inhibitor pyrrole-2- carboxylate (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 1eliA
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), G12 (= G49), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), G42 (= G80), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), S200 (≠ A236), M201 (≠ G237), G202 (= G238), W204 (= W240)
- binding pyrrole-2-carboxylate: R52 (≠ N90)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
- binding pyrrole-2-carboxylate: 245, 254, 269, 344, 345, 348
1el9A Complex of monomeric sarcosine oxidase with the inhibitor [methylthio]acetate (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 1el9A
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), G42 (= G80), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), S200 (≠ A236), M201 (≠ G237), G202 (= G238), W204 (= W240)
- binding [methylthio]acetate: I50 (≠ Q88), R52 (≠ N90)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding [methylthio]acetate: 245, 254, 269, 344, 348
1el8A Complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 1el8A
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), G42 (= G80), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), M201 (≠ G237), G202 (= G238), W204 (= W240)
- binding [methylseleno]acetate: I50 (≠ Q88), R52 (≠ N90)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding [methylseleno]acetate: 245, 254, 344, 345, 348
1el7A Complex of monomeric sarcosine oxidase with the inhibitor [methytelluro]acetate (see paper)
26% identity, 45% coverage: 42:253/466 of query aligns to 5:217/385 of 1el7A
- active site: H45 (≠ W83), T48 (≠ V86), R49 (= R87), R52 (≠ N90), S98 (= S132)
- binding flavin-adenine dinucleotide: G10 (= G47), S13 (≠ I50), M14 (≠ V51), V32 (≠ L69), D33 (≠ E70), A34 (≠ G72), H39 (≠ E77), G42 (= G80), S43 (≠ R81), H44 (≠ N82), R49 (= R87), I50 (≠ Q88), R172 (≠ A207), V173 (= V208), S200 (≠ A236), M201 (≠ G237), G202 (= G238), W204 (= W240)
- binding [methyltelluro]acetate: I50 (≠ Q88), R52 (≠ N90)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
- binding [methyltelluro]acetate: 245, 254, 269, 344, 345, 348
Query Sequence
>H281DRAFT_02718 FitnessBrowser__Burk376:H281DRAFT_02718
MRALVRIPELTTAVHQEAATGGCEMLRIDEVTNSESFPDRCDVAVIGGGIVGVSTAYELA
RRGVQVVLLEKGVIGGEQSGRNWGWVRQQNRDLYELPLAMQSLRRWEELSGELGEDIGFR
RAGILYGTELQSDVAQWESWIARAREIGFNSEILSARELAARIPSGRARWAGGLWSITDG
RAEPSKAAPAIARGAQRLGARVFQNCAVRSLDMSAGRVGGIWTERGRLAADTVVLAGGAW
SALFCQHHGIDLPAINVIGTALRTAEAPAVVEGCFSGPDFALRRRLDGGYTIAVPGYGRV
ELAPQNPRHSVKFRTMFRSKLKKKLKVRVGTSFFHGPEANATWRDDDISPFERTRVLDPR
VDSEWLERGLRNVARVFPELSGLRIAHAWAGAIDTTPDLVPIISKVDAKPGLVIASGFSG
HGFGLGPGAGLLASRLVMNEAPQFDMGPYRLTRFSDGTKLSSPEMM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory