SitesBLAST
Comparing H281DRAFT_02853 FitnessBrowser__Burk376:H281DRAFT_02853 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
2jjbA Family 37 trehalase from escherichia coli in complex with casuarine-6- o-alpha-glucopyranose (see paper)
55% identity, 88% coverage: 66:564/564 of query aligns to 3:494/504 of 2jjbA
- binding casuarine: F113 (= F181), W119 (= W187), D120 (= D188), G270 (= G338), D272 (= D340), W407 (= W474), F476 (= F546), W478 (= W548)
- binding alpha-D-glucopyranose: R112 (= R180), Y117 (= Y185), N156 (= N224), Y162 (= Y230), R165 (= R233), R237 (= R305), E239 (= E307), D272 (= D340)
2jg0A Family 37 trehalase from escherichia coli in complex with 1- thiatrehazolin (see paper)
56% identity, 88% coverage: 66:564/564 of query aligns to 1:496/507 of 2jg0A
- binding N-[(3aS,4R,5S,6S,6aS)-4,5,6-trihydroxy-4-(hydroxymethyl)-4,5,6,6a-tetrahydro-3aH-cyclopenta[d][1,3]thiazol-2-yl]-alpha- D-glucopyranosylamine: R112 (= R180), F113 (= F181), Y117 (= Y185), W119 (= W187), D120 (= D188), N156 (= N224), Y162 (= Y230), R165 (= R233), R237 (= R305), E239 (= E307), A267 (= A335), G270 (= G338), D272 (= D340), W407 (= W474), E471 (= E539), Y472 (= Y540), F478 (= F546), W480 (= W548)
2jf4A Family 37 trehalase from escherichia coli in complex with validoxylamine (see paper)
55% identity, 88% coverage: 66:564/564 of query aligns to 1:489/500 of 2jf4A
- binding (1s,2s,3r,6s)-4-(hydroxymethyl)-6-{[(1s,2s,3s,4r,5r)-2,3,4-trihydroxy-5-(hydroxymethyl)cyclohexyl]amino}cyclohex-4-ene-1,2,3-triol: F106 (= F181), Y110 (= Y185), W112 (= W187), D113 (= D188), N149 (= N224), R158 (= R233), R230 (= R305), E232 (= E307), G263 (= G338), D265 (= D340), W400 (= W474), E464 (= E539), Y465 (= Y540), F471 (= F546), W473 (= W548)
2wynA Structure of family 37 trehalase from escherichia coli in complex with a casuarine-6-o-a-d-glucoside analogue (see paper)
55% identity, 88% coverage: 66:564/564 of query aligns to 3:496/506 of 2wynA
- binding alpha-D-glucopyranose: Y117 (= Y185), N156 (= N224), Y162 (= Y230), R165 (= R233), R237 (= R305), E239 (= E307)
- binding (1r,2r,3r,6r,7r,7ar)-3,7-bis(hydroxymethyl)hexahydro-1h-pyrrolizine-1,2,6-triol: F113 (= F181), W119 (= W187), D120 (= D188), G270 (= G338), D272 (= D340), W407 (= W474), Y472 (= Y540), F478 (= F546), W480 (= W548)
5z66A Structure of periplasmic trehalase from diamondback moth gut bacteria complexed with validoxylamine (see paper)
55% identity, 88% coverage: 68:562/564 of query aligns to 5:500/512 of 5z66A
- binding (1s,2s,3r,6s)-4-(hydroxymethyl)-6-{[(1s,2s,3s,4r,5r)-2,3,4-trihydroxy-5-(hydroxymethyl)cyclohexyl]amino}cyclohex-4-ene-1,2,3-triol: P116 (= P177), F120 (= F181), Y124 (= Y185), W126 (= W187), D127 (= D188), N163 (= N224), Y169 (= Y230), Q174 (= Q235), R243 (= R305), E245 (= E307), G276 (= G338), D278 (= D340), W413 (= W474), E477 (= E539), Y478 (= Y540), F484 (= F546), W486 (= W548)
Q9W2M2 Trehalase; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Drosophila melanogaster (Fruit fly) (see paper)
32% identity, 86% coverage: 74:557/564 of query aligns to 59:574/596 of Q9W2M2
- N451 (≠ W442) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7eawA Trehalase of arabidopsis thaliana acid mutant -d380a trehalose complex
30% identity, 84% coverage: 87:560/564 of query aligns to 32:542/560 of 7eawA
- binding alpha-D-glucopyranose: R150 (= R180), F151 (= F181), F151 (= F181), Y155 (= Y185), W157 (= W187), D158 (= D188), N194 (= N224), Y200 (= Y230), Q205 (= Q235), R270 (= R305), E272 (= E307), A301 (= A335), E506 (= E523), E521 (≠ G538), Y522 (≠ E539), Y522 (≠ E539)
5n6nC Crystal structure of the 14-3-3:neutral trehalase nth1 complex (see paper)
30% identity, 67% coverage: 173:551/564 of query aligns to 253:658/698 of 5n6nC
- binding beta-D-fructofuranose: F261 (= F181), N297 (≠ D217), H298 (≠ T218), G300 (= G220), K351 (= K264), D425 (= D340), Q570 (= Q473)
- binding alpha-D-glucopyranose: P257 (= P177), W267 (= W187), D268 (= D188), H298 (≠ T218), G423 (= G338), D425 (= D340), Q487 (≠ A400), A529 (= A441), T530 (≠ W442), K531 (≠ P443), W571 (= W474), W655 (= W548)
Sites not aligning to the query:
P32356 Cytosolic neutral trehalase; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
30% identity, 67% coverage: 173:551/564 of query aligns to 295:711/751 of P32356
- WD 309:310 (= WD 187:188) binding
- N346 (= N224) binding
- RSQ 355:357 (= RSQ 233:235) binding
- E424 (≠ R291) binding
- R473 (≠ A335) binding
- S475 (= S337) mutation to A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-135; A-149 and A-260.
- G476 (= G338) binding
- D478 (= D340) mutation to A: Abolishes catalytic activity.
- E674 (= E523) mutation to A: Abolishes catalytic activity.
- R686 (≠ G535) mutation to A: Decreases catalytic activity.
- E690 (= E539) mutation to A: Severely decreases catalytic activity.
- Y691 (= Y540) mutation to A: Abolishes catalytic activity.
Sites not aligning to the query:
- 20 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-21; A-58; A-60; A-83; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-21; A-60 and A-83.
- 21 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-20; A-58; A-60; A-83; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-20; A-60 and A-83.
- 55 BMH1 binding
- 58 T→A: Abolishes activity; when associated with A-20; A-21; A-60; A-83; A-135; A-149; A-260 and A-475.
- 60 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-20; A-21; A-58; A-83; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-20; A-21 and A-83.
- 83 modified: Phosphoserine; by PKA; S→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-135; A-149; A-260 and A-475. Abolishes activation by BMH1 and BMH2; when associated with A-20; A-21 and A-60.
- 114 binding
- 116 binding
- 118 binding
- 120 binding ; Q→A: Decreases catalytic activity.
- 125 binding
- 135 T→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-149; A-260 and A-475.
- 149 T→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-135; A-260 and A-475.
- 260 T→A: Abolishes activity; when associated with A-20; A-21; A-58; A-60; A-83; A-135; A-149 and A-475.
O42893 Cytosolic neutral trehalase; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; Neutral trehalase; EC 3.2.1.28 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 3 papers)
30% identity, 67% coverage: 173:551/564 of query aligns to 276:689/735 of O42893
Sites not aligning to the query:
- 6 S→A: Abolishes activation during osmotic stress and thermal stress. Increases cellular trehalose level during osmotic stress but not thermal stress. Does not affect binding to tps1.
- 41 S→A: Decreases activation during osmotic stress and thermal stress. Increases cellular trehalose level during osmotic stress but not thermal stress. Does not affect binding to tps1.
- 47 modified: Phosphothreonine
- 49 modified: Phosphoserine
- 50 modified: Phosphothreonine
- 51 modified: Phosphoserine; S→A: Abolishes activation during osmotic stress and thermal stress. Increases cellular trehalose level during osmotic stress but not thermal stress. Does not affect binding to tps1.
- 71 mutation S->A,D: Abolishes activation and increases cellular trehalose level during osmotic stress and thermal stress. Does not affect binding to tps1.
- 97 D→L: Abolishes calcium binding. Abolishes activation and increases cellular trehalose level during osmotic stress and thermal stress.
- 100 R→L: Decreases calcium binding. Decreases activation and increases cellular trehalose level during osmotic stress and thermal stress. Does not affect binding to tps1.
- 108 D→L: Abolishes calcium binding. Abolishes activation and increases cellular trehalose level during osmotic stress and thermal stress. Does not affect binding to tps1.
Query Sequence
>H281DRAFT_02853 FitnessBrowser__Burk376:H281DRAFT_02853
MIVSSQARSISRAGNVSGVPGVLVQPSLPAARLKYLHRAVAVSGFAFLVGLSSVCRADTQ
VGGTLPPAPDILYGDLFVAVQTAQIYPDQKTFVDATPNADPAVIVQLYQQQRGKPGFSLA
NFVNQYFTPPSEPVITPPANQTLREHINWLWPALTRTTTSAPPNSSLIPLPKPYVVPGGR
FREGYYWDTYFTMLGLQEAGREDLVDNMLDNFAYMIDTFGHIPNGNRTYYLDRSQPPFFS
HMVELAAKVEGHGVYQKYLPALRKEYGYWMQGEKSTPAGSATRNVVVMPDRTVLNRYWDE
LDTPRDESYLEDIQTAQKATGRNPNDVYRELRATAESGWDFSSRWFGDNMTLATVRTTSI
IPVDLNSLMFHLEISIAKGCSETRDFRCVGEFAGRAAKRALGINRYLWNPNGYYGDYDWQ
LAKPRDNKTAAMVFPLFVGAAWPERAQKTAQQVQSTLLQPGGLATTTYNTTQQWDAPNGW
APLHWVAIQGLKRYGHDALAQQIGTRFLTDVKGVYASDKKLVEKYVVEGAGTGGGGGGEY
PLQDGFGWTNGVTLKLLDLYSPGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory