Comparing H281DRAFT_03194 FitnessBrowser__Burk376:H281DRAFT_03194 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 92% coverage: 32:386/386 of query aligns to 2:343/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
44% identity, 92% coverage: 32:386/386 of query aligns to 3:344/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
44% identity, 92% coverage: 32:386/386 of query aligns to 3:344/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
44% identity, 92% coverage: 32:386/386 of query aligns to 3:344/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
45% identity, 60% coverage: 48:277/386 of query aligns to 14:241/241 of 4u00A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
44% identity, 58% coverage: 52:276/386 of query aligns to 17:240/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
44% identity, 57% coverage: 52:272/386 of query aligns to 19:238/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
44% identity, 57% coverage: 52:272/386 of query aligns to 19:238/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
44% identity, 57% coverage: 52:272/386 of query aligns to 19:238/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
44% identity, 57% coverage: 52:272/386 of query aligns to 19:238/242 of 2oljA
Sites not aligning to the query:
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
43% identity, 57% coverage: 32:251/386 of query aligns to 2:216/222 of 8i6rB
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
45% identity, 52% coverage: 34:235/386 of query aligns to 4:200/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
45% identity, 52% coverage: 34:235/386 of query aligns to 4:200/222 of P0A9R7
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
44% identity, 57% coverage: 32:251/386 of query aligns to 3:218/227 of 8igqA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
44% identity, 57% coverage: 32:251/386 of query aligns to 3:218/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
44% identity, 57% coverage: 32:251/386 of query aligns to 2:217/229 of A5U7B7
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
44% identity, 52% coverage: 34:235/386 of query aligns to 4:200/218 of 8hd0A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 60% coverage: 49:278/386 of query aligns to 39:265/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 60% coverage: 49:278/386 of query aligns to 39:265/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
35% identity, 57% coverage: 49:269/386 of query aligns to 39:260/260 of 7ahdC
Sites not aligning to the query:
>H281DRAFT_03194 FitnessBrowser__Burk376:H281DRAFT_03194
MANLFDVPQFIEEAPSAAADHRANAAPAQSAVVFDHVGKVFAGSSGAPTAALAEVTLNVA
RGEVFGIIGRSGAGKSTLLRLVNGLEKPSSGAVRVNGINVGELDERGLVTLRRRIGMVFQ
HFNLLSAKTVRENIALPLKIAGVPKAAIDRKVDALLELVGLAAKRDAYPASLSGGQKQRV
GIARALVTDPDILLCDEATSALDPETTQAILALLRDINRRLNLTVVLITHEMQVIREVCD
TVAVIERGRVVETGPVWRVFGEPQHDATRALLRTLVHDLPADLADRVKPLAGIAQADARV
LLDVRFTGGNARDPDLASLTSALSIDGGGVSFVHGGIDRIQGHAQGRLIVSAQVRAKKGA
TVHAQVAALVERARGHANHVEVLGYV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory