SitesBLAST
Comparing H281DRAFT_03278 FitnessBrowser__Burk376:H281DRAFT_03278 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
32% identity, 98% coverage: 1:392/402 of query aligns to 1:337/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (≠ T40), H43 (= H43), H59 (= H60), E60 (= E61), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), G107 (≠ T116), D152 (= D162), T156 (= T166)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (≠ T40), T156 (= T166), G178 (= G188), P179 (= P189), V180 (= V190), D200 (= D210), R201 (= R211), R205 (= R215), A243 (= A253), V244 (= V254), V266 (≠ I321), V268 (= V323), L292 (≠ N347), A293 (≠ C348), F333 (= F388)
- binding zinc ion: C38 (= C38), H59 (= H60), C89 (= C90), C92 (= C93), C95 (= C96), C103 (= C104), D152 (= D162)
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
39% identity, 64% coverage: 1:258/402 of query aligns to 5:246/348 of 5ylnA
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
40% identity, 67% coverage: 2:269/402 of query aligns to 3:276/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (≠ T40), H50 (= H43), D168 (= D162), T172 (= T166), G194 (= G188), P195 (= P189), V196 (= V190), D216 (= D210), R221 (= R215), V261 (= V254), R266 (≠ V259), H268 (≠ A261)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D168 (= D162)
Sites not aligning to the query:
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
41% identity, 64% coverage: 2:258/402 of query aligns to 3:265/396 of 1kolA
- active site: C45 (= C38), G46 (= G39), S47 (≠ T40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), N114 (= N108), D168 (= D162), T172 (= T166)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (≠ T40), H50 (= H43), F92 (≠ S86), D168 (= D162), T172 (= T166), G192 (= G186), G194 (= G188), P195 (= P189), V196 (= V190), D216 (= D210), L217 (≠ R211), R221 (= R215), A260 (= A253), V261 (= V254)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D168 (= D162)
Sites not aligning to the query:
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
41% identity, 64% coverage: 2:258/402 of query aligns to 5:267/399 of P46154
- C47 (= C38) binding
- GSDQH 48:52 (≠ GTDLH 39:43) binding
- H68 (= H60) binding
- C98 (= C90) binding
- C101 (= C93) binding
- C104 (= C96) binding
- C112 (= C104) binding
- V198 (= V190) binding
- D218 (= D210) binding
- R223 (= R215) binding
- V263 (= V254) binding
Sites not aligning to the query:
- 268:270 binding
- 300:302 binding
- 337:339 binding
2dphA Crystal structure of formaldehyde dismutase
37% identity, 64% coverage: 2:258/402 of query aligns to 4:266/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (≠ T40), H50 (= H43), H66 (= H60), E67 (= E61), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), L114 (vs. gap), S168 (= S161), D169 (= D162), P172 (= P165)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (≠ T40), H50 (= H43), F92 (≠ S86), D169 (= D162), T173 (= T166), A192 (≠ F185), G193 (= G186), G195 (= G188), P196 (= P189), V197 (= V190), G216 (≠ V209), D217 (= D210), Q218 (≠ R211), R222 (= R215), L236 (≠ F229), V262 (= V254)
- binding zinc ion: C45 (= C38), H66 (= H60), C96 (= C90), C99 (= C93), C102 (= C96), C110 (= C104), D169 (= D162)
Sites not aligning to the query:
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
37% identity, 64% coverage: 2:258/402 of query aligns to 5:267/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
- 268 binding
- 299 binding
- 299:301 binding
- 336:338 binding
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
36% identity, 57% coverage: 3:232/402 of query aligns to 5:224/357 of 7y9pA
3fpcA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. Brockii adh by e. Histolytica adh (see paper)
37% identity, 57% coverage: 25:255/402 of query aligns to 24:244/352 of 3fpcA
- active site: C37 (= C38), T38 (≠ G39), S39 (≠ T40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ P109), D150 (= D162), T154 (= T166)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D162)
Sites not aligning to the query:
2ouiA D275p mutant of alcohol dehydrogenase from protozoa entamoeba histolytica (see paper)
36% identity, 63% coverage: 1:255/402 of query aligns to 1:244/360 of 2ouiA
- active site: C37 (= C38), T38 (≠ G39), S39 (≠ T40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), E92 (≠ C93), S95 (≠ C96), S103 (= S113), D150 (= D162), T154 (= T166)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D162)
Sites not aligning to the query:
1y9aA Alcohol dehydrogenase from entamoeba histolotica in complex with cacodylate (see paper)
36% identity, 63% coverage: 1:255/402 of query aligns to 1:244/360 of 1y9aA
- active site: C37 (= C38), T38 (≠ G39), S39 (≠ T40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), E92 (≠ C93), S95 (≠ C96), S103 (= S113), D150 (= D162), T154 (= T166)
- binding acetate ion: P24 (= P25), G69 (= G70), S70 (≠ R71)
- binding cacodylate ion: S39 (≠ T40), H59 (= H60), W110 (≠ P122), D150 (= D162)
- binding 1,2-ethanediol: G98 (= G99), Y99 (= Y100), M101 (≠ A102), H157 (≠ F169)
- binding zinc ion: C37 (= C38), D51 (≠ M52), H53 (≠ P54), H59 (= H60), D150 (= D162)
Sites not aligning to the query:
P35630 NADP-dependent isopropanol dehydrogenase; EhADH1; EC 1.1.1.80 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
36% identity, 63% coverage: 1:255/402 of query aligns to 7:250/366 of P35630
- C43 (= C38) binding
- H65 (= H60) binding
- E66 (= E61) binding
- D156 (= D162) binding
4eezB Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1 (see paper)
37% identity, 57% coverage: 24:251/402 of query aligns to 25:237/342 of 4eezB
- active site: C39 (= C38), H40 (≠ G39), T41 (= T40), H44 (= H43), H60 (= H60), E61 (= E61), C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104), K109 (≠ N108), C147 (≠ D162), T151 (= T166)
- binding zinc ion: C39 (= C38), H60 (= H60), E61 (= E61), C91 (= C90), C94 (= C93), C97 (= C96), C105 (= C104), C147 (≠ D162)
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
37% identity, 57% coverage: 25:255/402 of query aligns to 25:245/344 of 7xy9A
Sites not aligning to the query:
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
37% identity, 57% coverage: 25:255/402 of query aligns to 22:242/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D162), T152 (= T166), G172 (= G186), I173 (≠ A187), G174 (= G188), P175 (= P189), V176 (= V190), R198 (≠ I212), G242 (= G255)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (≠ T40), H57 (= H60), W108 (≠ T116), D148 (= D162)
- binding zinc ion: C35 (= C38), H57 (= H60), E58 (= E61), D148 (= D162)
Sites not aligning to the query:
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
37% identity, 57% coverage: 25:255/402 of query aligns to 24:244/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (≠ T40), H59 (= H60), A85 (≠ S86), W110 (≠ T116), D150 (= D162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C38), T38 (≠ G39), S39 (≠ T40), D150 (= D162), T154 (= T166), G174 (= G186), G176 (= G188), P177 (= P189), V178 (= V190), S199 (≠ R211), R200 (≠ I212), A242 (= A253), G243 (≠ V254), G244 (= G255)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D162)
Sites not aligning to the query:
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
37% identity, 57% coverage: 25:255/402 of query aligns to 24:244/352 of 1ykfA
- active site: C37 (= C38), T38 (≠ G39), S39 (≠ T40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ P109), D150 (= D162), T154 (= T166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ T40), D150 (= D162), T154 (= T166), G174 (= G186), I175 (≠ A187), G176 (= G188), P177 (= P189), V178 (= V190), S199 (≠ R211), R200 (≠ I212), Y218 (≠ F229), I223 (≠ P234)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D162)
Sites not aligning to the query:
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
37% identity, 57% coverage: 25:255/402 of query aligns to 24:244/352 of 1bxzB
- active site: C37 (= C38), T38 (≠ G39), S39 (≠ T40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ P109), D150 (= D162), T154 (= T166)
- binding 2-butanol: H59 (= H60), D150 (= D162)
Sites not aligning to the query:
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
37% identity, 57% coverage: 25:255/402 of query aligns to 24:244/352 of P14941
Sites not aligning to the query:
- 265:267 binding
- 340 binding
3fsrA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. Brockii adh by c. Beijerinckii adh (see paper)
36% identity, 57% coverage: 25:255/402 of query aligns to 24:244/352 of 3fsrA
- active site: C37 (= C38), T38 (≠ G39), S39 (≠ T40), H42 (= H43), H59 (= H60), E60 (= E61), D89 (≠ C90), T92 (≠ C93), V95 (≠ C96), S103 (≠ P109), D150 (= D162), T154 (= T166)
- binding zinc ion: C37 (= C38), H59 (= H60), D150 (= D162)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_03278 FitnessBrowser__Burk376:H281DRAFT_03278
MKAVVFHGIGDIRLDNVPDPKLEQPTDALVRLTSSAICGTDLHMVRGTLGGMVPGTILGH
EGIGIVEEVGRSVRNLRQGDRVLIPSTISCGFCSYCRSGYTAQCDNANPNGASAGTAFFG
GPKTTGPFQGLQAQYARTPLAHASLIRLPDEIDDDRAILLSDIFPTGYFGAQLAGVRTGD
TVAVFGAGPVGQFAIASAKLMGAGRVIAVDRIASRLDMARTQGAEVINFDEEDPVDMILQ
LTGGIGVDRVIDAVGVDAVRAEHGPAAQKERDQQQAFDKEVKEIAPDTNPDGDNWRPGSG
PSQVLTWSVRAVAKAGTVSIIGVYPPNDRVFPIGEAMNRNLVVRMGNCNHRAITPHLVEI
VRNGSFDPLAVLTQREPITDAIEAYRAFDNREPGWIKVKLQP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory