SitesBLAST
Comparing H281DRAFT_03347 FitnessBrowser__Burk376:H281DRAFT_03347 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
29% identity, 90% coverage: 34:322/322 of query aligns to 11:291/298 of 4mynA
- active site: H110 (= H127), D134 (= D163), H136 (= H165), D138 (= D167), S150 (= S176), D224 (= D254), D226 (= D256), E269 (= E299)
- binding manganese (ii) ion: H110 (= H127), D134 (= D163), D134 (= D163), H136 (= H165), D138 (= D167), D224 (= D254), D224 (= D254), D226 (= D256)
6dktE Crystal structure of arginase from bacillus subtilis
26% identity, 86% coverage: 45:322/322 of query aligns to 5:263/268 of 6dktE
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
26% identity, 81% coverage: 62:322/322 of query aligns to 56:313/321 of 3m1rD
- active site: N130 (≠ H127), D153 (= D163), H155 (= H165), D157 (= D167), N168 (= N175), D245 (= D254), D247 (= D256), E290 (= E299)
- binding calcium ion: N130 (≠ H127), D153 (= D163), D153 (= D163), H155 (= H165), H155 (= H165), D157 (= D167), D245 (= D254), D245 (= D254), D247 (= D256)
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 71% coverage: 94:322/322 of query aligns to 71:280/284 of Q57757
- C71 (= C94) mutation to S: 24% of wild-type activity in the presence of DTT.
- C136 (≠ F166) mutation to A: 89% of wild-type activity in the presence of DTT.
- C151 (= C187) mutation to S: 5% of wild-type activity in the presence of DTT.
- C229 (≠ L272) mutation to A: 96% of wild-type activity in the presence of DTT.
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
25% identity, 84% coverage: 46:317/322 of query aligns to 12:263/276 of 3lhlA
- active site: H95 (= H127), D118 (= D163), H120 (= H165), D122 (= D167), H134 (≠ G177), D199 (= D254), D201 (= D256), E245 (= E299)
- binding manganese (ii) ion: H95 (= H127), D118 (= D163), D118 (= D163), H120 (= H165), D122 (= D167), D122 (= D167), H134 (≠ G177), D199 (= D254), D199 (= D254), D201 (= D256)
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
26% identity, 86% coverage: 45:322/322 of query aligns to 37:305/316 of 3nipB
- active site: H124 (= H127), D146 (= D163), H148 (= H165), D150 (= D167), H163 (≠ S176), D238 (= D254), D240 (= D256), E282 (= E299)
- binding hexane-1,6-diamine: R49 (= R60), P244 (≠ A260), F246 (≠ T262), P248 (= P264), A292 (≠ R309), V296 (≠ A313)
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
26% identity, 86% coverage: 45:322/322 of query aligns to 39:307/318 of Q9I6K2
- H126 (= H127) binding
- D148 (= D163) binding
- H150 (= H165) binding
- D152 (= D167) binding
- Y157 (vs. gap) mutation to M: Reduces substrate affinity 10-fold and catalytic efficiency 3-fold.
- D240 (= D254) binding
- D242 (= D256) binding
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
26% identity, 86% coverage: 45:322/322 of query aligns to 36:304/315 of 3niqA
- active site: H123 (= H127), D145 (= D163), H147 (= H165), D149 (= D167), H162 (≠ S176), D237 (= D254), D239 (= D256), E281 (= E299)
- binding manganese (ii) ion: H123 (= H127), D145 (= D163), D145 (= D163), H147 (= H165), D149 (= D167), D237 (= D254), D237 (= D254), D239 (= D256)
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
26% identity, 69% coverage: 102:322/322 of query aligns to 73:293/298 of 5cevA
- active site: H98 (= H127), D121 (= D163), H123 (= H165), D125 (= D167), H138 (vs. gap), D225 (= D254), D227 (= D256), E270 (= E299)
- binding guanidine: H251 (≠ E280), E255 (≠ L284)
- binding lysine: S134 (= S176), H138 (vs. gap), E270 (= E299)
- binding manganese (ii) ion: H98 (= H127), D121 (= D163), D121 (= D163), H123 (= H165), D125 (= D167), D225 (= D254), D225 (= D254), D227 (= D256)
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
26% identity, 69% coverage: 102:322/322 of query aligns to 73:293/298 of 4cevA
- active site: H98 (= H127), D121 (= D163), H123 (= H165), D125 (= D167), H138 (vs. gap), D225 (= D254), D227 (= D256), E270 (= E299)
- binding guanidine: H251 (≠ E280), E255 (≠ L284)
- binding manganese (ii) ion: H98 (= H127), D121 (= D163), D121 (= D163), H123 (= H165), D125 (= D167), D225 (= D254), D225 (= D254), D227 (= D256)
- binding L-ornithine: H123 (= H165), D125 (= D167), S134 (= S176), H138 (vs. gap), D177 (≠ G205)
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
26% identity, 69% coverage: 102:322/322 of query aligns to 73:293/298 of 3cevA
- active site: H98 (= H127), D121 (= D163), H123 (= H165), D125 (= D167), H138 (vs. gap), D225 (= D254), D227 (= D256), E270 (= E299)
- binding arginine: H123 (= H165), D125 (= D167), S134 (= S176), H138 (vs. gap), D225 (= D254), H251 (≠ E280), E255 (≠ L284), E270 (= E299)
- binding manganese (ii) ion: H98 (= H127), D121 (= D163), D125 (= D167), D225 (= D254)
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
26% identity, 69% coverage: 102:322/322 of query aligns to 73:293/298 of 2cevB
- active site: H98 (= H127), D121 (= D163), H123 (= H165), D125 (= D167), H138 (vs. gap), D225 (= D254), D227 (= D256), E270 (= E299)
- binding guanidine: H251 (≠ E280), E255 (≠ L284)
- binding manganese (ii) ion: H98 (= H127), D121 (= D163), D121 (= D163), H123 (= H165), D125 (= D167), D225 (= D254), D225 (= D254), D227 (= D256)
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
26% identity, 69% coverage: 102:322/322 of query aligns to 74:294/299 of 1cevA
- active site: H99 (= H127), D122 (= D163), H124 (= H165), D126 (= D167), H139 (vs. gap), D226 (= D254), D228 (= D256), E271 (= E299)
- binding manganese (ii) ion: H99 (= H127), D122 (= D163), D122 (= D163), H124 (= H165), D126 (= D167), D226 (= D254), D226 (= D254), D228 (= D256)
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
26% identity, 69% coverage: 102:322/322 of query aligns to 74:294/299 of P53608
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
26% identity, 82% coverage: 60:322/322 of query aligns to 51:307/316 of 3nioA
- active site: H126 (= H127), D149 (= D163), H151 (= H165), D153 (= D167), H165 (vs. gap), D240 (= D254), D242 (= D256), E284 (= E299)
- binding manganese (ii) ion: H126 (= H127), D149 (= D163), D149 (= D163), H151 (= H165), D153 (= D167), D240 (= D254), D240 (= D254), D242 (= D256)
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
26% identity, 82% coverage: 60:322/322 of query aligns to 54:310/319 of Q9I3S3
- H129 (= H127) binding
- D152 (= D163) binding ; binding
- H154 (= H165) binding
- D156 (= D167) binding
- M161 (≠ R172) mutation to Y: Loss of activity.
- D243 (= D254) binding
- D245 (= D256) binding
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
22% identity, 85% coverage: 45:317/322 of query aligns to 79:346/378 of 7esrA
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
28% identity, 74% coverage: 85:322/322 of query aligns to 96:312/323 of 4dz4B
- active site: H138 (= H127), D162 (= D163), H164 (= H165), D166 (= D167), H178 (≠ S176), D245 (= D254), D247 (= D256), E289 (= E299)
- binding manganese (ii) ion: H138 (= H127), D162 (= D163), D162 (= D163), H164 (= H165), D166 (= D167), D245 (= D254), D245 (= D254), D247 (= D256)
- binding unknown: H138 (= H127), D166 (= D167), H178 (≠ S176)
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
22% identity, 92% coverage: 23:317/322 of query aligns to 11:278/293 of 3pzlB
- active site: H112 (= H127), D132 (= D163), H134 (= H165), D136 (= D167), H148 (≠ G177), D217 (= D254), D219 (= D256), E260 (= E299)
- binding manganese (ii) ion: H112 (= H127), D132 (= D163), D132 (= D163), H134 (= H165), D136 (= D167), D217 (= D254), D217 (= D254), D219 (= D256)
6vstD Arginase from medicago truncatula in complex with ornithine (see paper)
27% identity, 73% coverage: 86:321/322 of query aligns to 92:314/320 of 6vstD
Query Sequence
>H281DRAFT_03347 FitnessBrowser__Burk376:H281DRAFT_03347
MRVPFDGKVWAGRSDDGEPGDTRRVFNQVTPFGSAQQVQRDVPVIVGFSSDEGVRRNQGR
IGAAHAPKELRRVLAGLPAKAAIAALADAGDVVCDDGDLEAAQAELAHVVSEVLASGARP
LVFGGGHEVAWGTYSGLRLHQQREAGNQATLLISRKLLIINFDAHFDLRQKRPANSGTPF
DQIALDCEERGVSFNYVCFGISDLGNTASLFAHAERLGVRYVLDVDMQETQLPQRLNELQ
KLLDAADDVYLTIDLDVLPAATAPGVSAPAALGVPLSVVEAMVLRVRASGKLRASDIAEY
NPTLDQDRRTARAAARLAYRLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory