Comparing H281DRAFT_03377 FitnessBrowser__Burk376:H281DRAFT_03377 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
25% identity, 85% coverage: 9:306/352 of query aligns to 7:279/315 of 7svqA
7eziA Rice l-galactose dehydrogenase (apo form)
28% identity, 84% coverage: 12:307/352 of query aligns to 16:286/323 of 7eziA
7ezlA Rice l-galactose dehydrogenase (holo form)
28% identity, 84% coverage: 12:307/352 of query aligns to 11:281/318 of 7ezlA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
25% identity, 88% coverage: 9:316/352 of query aligns to 5:299/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
25% identity, 88% coverage: 9:316/352 of query aligns to 6:300/310 of P46336
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
26% identity, 91% coverage: 4:322/352 of query aligns to 2:285/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
26% identity, 91% coverage: 4:322/352 of query aligns to 2:285/298 of 1ynpB
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
25% identity, 88% coverage: 12:322/352 of query aligns to 10:270/283 of 1ynpA
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
25% identity, 86% coverage: 8:309/352 of query aligns to 12:305/326 of P77256
3n6qD Crystal structure of yghz from e. Coli (see paper)
27% identity, 89% coverage: 11:323/352 of query aligns to 19:307/315 of 3n6qD
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 85% coverage: 7:305/352 of query aligns to 4:272/301 of 6ow0B
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
27% identity, 89% coverage: 11:323/352 of query aligns to 18:320/335 of 4aubB
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 89% coverage: 8:322/352 of query aligns to 11:339/351 of Q9P7U2
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
27% identity, 77% coverage: 12:281/352 of query aligns to 19:259/259 of 4exaF
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
24% identity, 85% coverage: 7:305/352 of query aligns to 4:296/323 of 6ow0A
1lqaA Tas protein from escherichia coli in complex with NADPH (see paper)
26% identity, 86% coverage: 9:310/352 of query aligns to 6:323/346 of 1lqaA
P0A9T4 Protein tas from Escherichia coli (strain K12) (see paper)
26% identity, 86% coverage: 9:310/352 of query aligns to 6:323/346 of P0A9T4
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
24% identity, 85% coverage: 11:309/352 of query aligns to 19:291/312 of 3erpA
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
23% identity, 85% coverage: 11:309/352 of query aligns to 20:296/315 of 5t79A
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
26% identity, 88% coverage: 11:320/352 of query aligns to 19:293/297 of 4aubE
>H281DRAFT_03377 FitnessBrowser__Burk376:H281DRAFT_03377
MKAFATQALPRSGLAMTTLGLGCSQLGGLYKPMSTAEANALLEWAWDAGIRYFDTAPFYG
YTLSERRVGQSLQMRERERYVLSTKVGRLMRPDDTVLPGDDNWAQPLPFRPRFDYTFDGI
MRSYEDSQQRLGMQTIDILYVHDIGAATHGDAHSRYWEQLTRGGGFRALAELRDSHAVSA
IGLGVNEWQVAVDSMQEADLDLVMLAGRYTLLEQEALSPLLDQCVSNGVRIVAGGVFNSG
VLVGNGKFNYTDAPPEVARKVARLADACAKFEVPLAAAALQFPLAHPAVVSCVVGARSIE
QLQKNIAWLETPVPPELWQALQHEGLIAGSAPVPEARRFFTTDQPSGDRQAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory