Comparing H281DRAFT_04159 FitnessBrowser__Burk376:H281DRAFT_04159 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
61% identity, 94% coverage: 26:440/440 of query aligns to 1:417/417 of 4ryaA
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
27% identity, 92% coverage: 28:431/440 of query aligns to 7:397/399 of 5iaiA
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
27% identity, 93% coverage: 29:435/440 of query aligns to 6:407/407 of 1eu8A
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
26% identity, 93% coverage: 29:435/440 of query aligns to 47:448/450 of Q7LYW7
6dtqA Maltose bound t. Maritima male3 (see paper)
26% identity, 87% coverage: 42:422/440 of query aligns to 18:380/391 of 6dtqA
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
24% identity, 92% coverage: 29:434/440 of query aligns to 6:386/390 of 7qhvAAA
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
23% identity, 95% coverage: 15:434/440 of query aligns to 13:416/416 of A9CEY9
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
23% identity, 92% coverage: 29:434/440 of query aligns to 7:388/389 of 7ofyA
7yzsAAA Sulfoquinovosyl binding protein (see paper)
24% identity, 88% coverage: 29:417/440 of query aligns to 5:369/384 of 7yzsAAA
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
24% identity, 88% coverage: 29:417/440 of query aligns to 4:366/382 of 7yzuA
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
24% identity, 78% coverage: 93:433/440 of query aligns to 69:391/393 of 5ci5A
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 75% coverage: 26:355/440 of query aligns to 3:321/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 75% coverage: 26:355/440 of query aligns to 3:321/388 of 3jzjA
Sites not aligning to the query:
4r9gA Cpmnbp1 with mannotriose bound (see paper)
25% identity, 67% coverage: 37:331/440 of query aligns to 13:312/394 of 4r9gA
Sites not aligning to the query:
1eljA The crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus (see paper)
22% identity, 73% coverage: 22:343/440 of query aligns to 1:306/380 of 1eljA
Sites not aligning to the query:
5f7vA Abc substrate-binding protein lmo0181 from listeria monocytogenes in complex with cycloalternan (see paper)
26% identity, 73% coverage: 42:362/440 of query aligns to 17:344/388 of 5f7vA
Sites not aligning to the query:
4r9fA Cpmnbp1 with mannobiose bound (see paper)
25% identity, 67% coverage: 37:331/440 of query aligns to 14:320/402 of 4r9fA
Sites not aligning to the query:
7v09A Crystal structure of ecl_rs08780, putative sugar transport system periplasmic sugar-binding protein
24% identity, 86% coverage: 42:420/440 of query aligns to 20:383/403 of 7v09A
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
27% identity, 48% coverage: 27:238/440 of query aligns to 1:212/385 of 2i58A
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
28% identity, 48% coverage: 28:238/440 of query aligns to 3:213/386 of 6preA
Sites not aligning to the query:
>H281DRAFT_04159 FitnessBrowser__Burk376:H281DRAFT_04159
MKPALKSALKAVSAGAAACFALSASAATVTIATLNNPDMIELKKLSPEFEKANPDIKLNW
VILEENVLRQRATTDITTGSGQFDVMTIGAYETPQWGKRGWLTPLTNLPADYDLNDVVKT
ARDGLSAGGQLYALPFYVESSMTYYRKDLFAAKGLKMPDQPTYDQIAQFADKLTDKANGM
YGICLRGKAGWGENMAYGTTVVNTFGGRWFDEKWHAQLTSPEWKKAITFYVDLLKKNGPP
GASSNGFNENLTLMSSGKCAMWIDATVAAGMLYNKQQSQIADKVGFAAAPIAVTPKGSHW
LWAWALAIPKSSKQADAAKKFITWATSKQYIELVAKDEGWASVPPGTRQSTYARPEYKQA
APFGDFVLKAIETADPEHPTAKPVPYTGVQFVGIPEFQSFGTVVGQSISGAIAGQMTVDQ
ALAAGQATADRAVKQAGYQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory