SitesBLAST
Comparing H281DRAFT_04843 FitnessBrowser__Burk376:H281DRAFT_04843 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
34% identity, 100% coverage: 1:309/310 of query aligns to 1:309/309 of 4zrnA
- active site: T117 (≠ S117), G119 (= G119), A120 (≠ T120), Y143 (= Y142), K147 (= K146), Y181 (≠ E180), G185 (= G184)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), N32 (≠ R32), S34 (≠ R34), S35 (≠ V35), G36 (= G36), S51 (≠ T51), I52 (≠ G52), L73 (= L73), A74 (≠ V74), A75 (≠ S75), T92 (≠ S92), S115 (≠ I115), S116 (= S116), Y143 (= Y142), K147 (= K146), Y170 (≠ V169), V173 (≠ P172)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S117), G119 (= G119), A120 (≠ T120), Y143 (= Y142), N172 (= N171), G185 (= G184), V186 (≠ A185), H201 (≠ E200), F203 (≠ W202), Y208 (≠ I207), R210 (= R209), V244 (≠ L244), R267 (= R267), D270 (= D270)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
35% identity, 98% coverage: 1:305/310 of query aligns to 1:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), N32 (≠ R32), T35 (≠ V35), G36 (= G36), D56 (= D53), I57 (≠ L54), L77 (= L73), A78 (≠ V74), A79 (≠ S75), I81 (≠ T77), V96 (≠ S92), T119 (≠ I115), Y146 (= Y142), K150 (= K146), P173 (≠ V169), A174 (= A170), N175 (= N171), V176 (≠ P172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ T77), R84 (≠ K80), S121 (= S117), G123 (= G119), Y146 (= Y142), A174 (= A170), N175 (= N171), A187 (≠ Q183), G188 (= G184), V189 (≠ A185), F193 (= F189), R204 (≠ E200), V205 (≠ I201), F206 (≠ W202), R213 (= R209), D248 (≠ L244), R271 (= R267)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
35% identity, 98% coverage: 1:305/310 of query aligns to 1:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), N32 (≠ R32), T35 (≠ V35), G36 (= G36), D56 (= D53), I57 (≠ L54), L77 (= L73), A78 (≠ V74), A79 (≠ S75), I81 (≠ T77), T119 (≠ I115), Y146 (= Y142), K150 (= K146), P173 (≠ V169), N175 (= N171), V176 (≠ P172)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ T77), R84 (≠ K80), S121 (= S117), G123 (= G119), S124 (≠ T120), Y146 (= Y142), A174 (= A170), N175 (= N171), G188 (= G184), V189 (≠ A185), F193 (= F189), R204 (≠ E200), V205 (≠ I201), F206 (≠ W202), N211 (≠ I207), R213 (= R209), D248 (≠ L244), R271 (= R267)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
35% identity, 98% coverage: 1:305/310 of query aligns to 1:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ T77), R84 (≠ K80), S121 (= S117), G123 (= G119), Y146 (= Y142), A174 (= A170), N175 (= N171), A187 (≠ Q183), G188 (= G184), V189 (≠ A185), F193 (= F189), R204 (≠ E200), F206 (≠ W202), N211 (≠ I207), R213 (= R209), D248 (≠ L244), R271 (= R267)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), N32 (≠ R32), A34 (≠ R34), T35 (≠ V35), G36 (= G36), D56 (= D53), I57 (≠ L54), L77 (= L73), A78 (≠ V74), A79 (≠ S75), I81 (≠ T77), T119 (≠ I115), Y146 (= Y142), K150 (= K146), P173 (≠ V169), A174 (= A170), V176 (≠ P172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ T77), R84 (≠ K80), S121 (= S117), G123 (= G119), Y146 (= Y142), A174 (= A170), N175 (= N171), A187 (≠ Q183), G188 (= G184), V189 (≠ A185), F193 (= F189), R204 (≠ E200), F206 (≠ W202), N211 (≠ I207), R213 (= R209), D248 (≠ L244), R271 (= R267)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 96% coverage: 2:298/310 of query aligns to 2:301/307 of 6wjaA
- active site: A118 (≠ S117), A119 (≠ G118), A120 (≠ G119), F143 (≠ Y142), K147 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), D32 (≠ R32), S34 (≠ R34), T35 (≠ V35), G36 (= G36), A55 (≠ L54), L74 (= L73), A75 (≠ V74), A76 (≠ S75), S93 (= S92), F143 (≠ Y142), K147 (= K146), F170 (≠ V169), F171 (≠ A170), I173 (≠ P172)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P79), A120 (≠ G119), N172 (= N171), G186 (= G184), V187 (≠ A185), F191 (= F189), T202 (≠ E200), F204 (≠ W202), R211 (= R209), L247 (= L244), R270 (= R267), D273 (= D270)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 96% coverage: 2:298/310 of query aligns to 3:302/308 of 6wj9B
- active site: A119 (≠ S117), A120 (≠ G118), A121 (≠ G119), F144 (≠ Y142), K148 (= K146)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D32 (≠ E31), D33 (≠ R32), S35 (≠ R34), T36 (≠ V35), G37 (= G36), D55 (= D53), A56 (≠ L54), L75 (= L73), A76 (≠ V74), A77 (≠ S75), S94 (= S92), A117 (≠ I115), A119 (≠ S117), F144 (≠ Y142), K148 (= K146), F171 (≠ V169), F172 (≠ A170), I174 (≠ P172)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P79), N173 (= N171), G187 (= G184), V188 (≠ A185), F192 (= F189), T203 (≠ E200), L204 (≠ I201), F205 (≠ W202), R212 (= R209), L248 (= L244), R271 (= R267), D274 (= D270)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
35% identity, 99% coverage: 1:308/310 of query aligns to 1:311/311 of 2p5uA
- active site: T117 (≠ S117), G119 (= G119), A120 (≠ T120), Y143 (= Y142), K147 (= K146), H181 (≠ E180), G185 (= G184)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), N32 (≠ R32), L33 (≠ A33), A34 (≠ R34), T35 (≠ V35), G36 (= G36), D51 (= D53), L52 (= L54), Q73 (≠ L73), A74 (≠ V74), A75 (≠ S75), A77 (≠ T77), S116 (= S116), Y143 (= Y142), K147 (= K146), V173 (≠ P172)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
28% identity, 99% coverage: 1:306/310 of query aligns to 1:311/313 of 6bwlA
- active site: T122 (≠ S117), C123 (≠ G118), M124 (≠ T120), Y147 (= Y142), K151 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), F11 (= F11), I12 (= I12), D31 (≠ E31), N32 (≠ R32), L33 (vs. gap), N35 (vs. gap), S36 (≠ A33), D57 (= D53), I58 (≠ L54), L79 (= L73), A80 (≠ V74), A81 (≠ S75), I83 (≠ T77), M120 (≠ I115), K151 (= K146), N176 (= N171), T177 (≠ P172)
- binding uridine-5'-diphosphate: N176 (= N171), G189 (= G184), V190 (≠ A185), N205 (≠ E200), I206 (= I201), Y207 (≠ W202), Q212 (≠ I207), R214 (= R209), I250 (≠ L244), E275 (≠ D270)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 1kvrA
- active site: A124 (≠ G118), A125 (≠ G119), T126 (= T120), Y149 (= Y142), K153 (= K146), M189 (≠ R178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), S122 (= S116), S123 (= S117), Y149 (= Y142), K153 (= K146), Y177 (≠ V169), P180 (= P172)
- binding uridine-5'-diphosphate: N179 (= N171), N198 (vs. gap), N199 (≠ A185), L200 (≠ I186), A216 (≠ E200), I217 (= I201), F218 (≠ W202), R231 (= R209), Y233 (= Y211), V269 (≠ L244), R292 (= R267), D295 (= D270)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 2udpA
- active site: S124 (≠ G118), A125 (≠ G119), T126 (= T120), Y149 (= Y142), K153 (= K146), M189 (≠ R178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), S122 (= S116), S124 (≠ G118), Y149 (= Y142), K153 (= K146), Y177 (≠ V169)
- binding phenyl-uridine-5'-diphosphate: N179 (= N171), N199 (≠ A185), L200 (≠ I186), A216 (≠ E200), I217 (= I201), F218 (≠ W202), R231 (= R209), Y233 (= Y211), V269 (≠ L244), R292 (= R267), D295 (= D270)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 1udcA
- active site: S124 (≠ G118), A125 (≠ G119), T126 (= T120), Y149 (= Y142), K153 (= K146), M189 (≠ R178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), S122 (= S116), Y149 (= Y142), K153 (= K146), Y177 (≠ V169), P180 (= P172)
- binding uridine-5'-diphosphate-mannose: T126 (= T120), Y149 (= Y142), N179 (= N171), N199 (≠ A185), L200 (≠ I186), L215 (≠ I199), A216 (≠ E200), I217 (= I201), F218 (≠ W202), R231 (= R209), Y233 (= Y211), V269 (≠ L244), R292 (= R267)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of P09147
- YI 11:12 (≠ FI 11:12) binding
- DNLCNS 31:36 (≠ E----- 31) binding
- DI 58:59 (≠ DL 53:54) binding
- FAGLK 80:84 (≠ LVSTT 73:77) binding
- N99 (≠ S92) binding
- S124 (≠ G118) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y142) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K146) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (≠ A170) binding
- Y299 (≠ S274) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 1udaA
- active site: S124 (≠ G118), A125 (≠ G119), T126 (= T120), Y149 (= Y142), K153 (= K146), M189 (≠ R178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), S122 (= S116), Y149 (= Y142), K153 (= K146), Y177 (≠ V169), P180 (= P172)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T120), N179 (= N171), N199 (≠ A185), L200 (≠ I186), A216 (≠ E200), I217 (= I201), F218 (≠ W202), R231 (= R209), Y233 (= Y211), R292 (= R267), D295 (= D270), Y299 (≠ S274)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 1naiA
- active site: S124 (≠ G118), A125 (≠ G119), T126 (= T120), Y149 (= Y142), K153 (= K146), M189 (≠ R178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), Y149 (= Y142), K153 (= K146), Y177 (≠ V169), P180 (= P172)
- binding 1,3-propandiol: N35 (vs. gap), K84 (≠ T77), E191 (= E180), P193 (≠ A182)
- binding uridine-5'-diphosphate: N179 (= N171), N199 (≠ A185), L200 (≠ I186), L215 (≠ I199), A216 (≠ E200), R231 (= R209), Y233 (= Y211), R292 (= R267)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
30% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 1lrjA
- active site: S124 (≠ G118), A125 (≠ G119), T126 (= T120), Y149 (= Y142), K153 (= K146), M189 (≠ R178)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), L33 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), Y149 (= Y142), K153 (= K146), Y177 (≠ V169), P180 (= P172)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (≠ P79), S124 (≠ G118), F178 (≠ A170), N179 (= N171), L200 (≠ I186), L215 (≠ I199), A216 (≠ E200), F218 (≠ W202), R231 (= R209), Y233 (= Y211), V269 (≠ L244), R292 (= R267), D295 (= D270)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
29% identity, 98% coverage: 1:303/310 of query aligns to 1:328/338 of 1a9yA
- active site: A124 (≠ G118), A125 (≠ G119), T126 (= T120), F149 (≠ Y142), K153 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G10 (= G10), Y11 (≠ F11), I12 (= I12), D31 (≠ E31), N32 (vs. gap), C34 (vs. gap), N35 (vs. gap), S36 (vs. gap), D58 (= D53), I59 (≠ L54), F80 (≠ L73), A81 (≠ V74), G82 (≠ S75), K84 (≠ T77), S122 (= S116), S123 (= S117), F149 (≠ Y142), K153 (= K146), Y177 (≠ V169), P180 (= P172)
- binding uridine-5'-diphosphate-glucose: A125 (≠ G119), T126 (= T120), N179 (= N171), N199 (≠ A185), L200 (≠ I186), A216 (≠ E200), I217 (= I201), F218 (≠ W202), R231 (= R209), Y233 (= Y211), R292 (= R267), D295 (= D270), Y299 (≠ S274)
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
26% identity, 99% coverage: 2:308/310 of query aligns to 3:308/312 of 2b69A
- active site: T115 (≠ G118), S116 (≠ G119), E117 (≠ T120), Y144 (= Y142), K148 (= K146), R185 (≠ Q183)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), V13 (≠ I12), D32 (≠ E31), N33 (≠ R32), T36 (≠ V35), G37 (= G36), D57 (= D59), V58 (≠ I60), L72 (= L73), A73 (≠ V74), S74 (= S75), A76 (≠ T77), T91 (≠ S92), T115 (≠ G118), Y144 (= Y142), K148 (= K146), I171 (≠ V169), N173 (= N171), R185 (≠ Q183)
- binding uridine-5'-diphosphate: P61 (≠ A63), L62 (≠ I64), Y63 (≠ D65), P78 (= P79), N98 (≠ H99), G101 (≠ N102), L102 (≠ V105), K104 (= K107), R105 (≠ S108), Y158 (= Y156), N173 (= N171), R185 (≠ Q183), V186 (≠ A185), N189 (≠ V188), T201 (≠ E200), Y203 (≠ W202), Q208 (≠ I207), R210 (= R209), I244 (≠ L244), D270 (= D270)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
26% identity, 99% coverage: 2:308/310 of query aligns to 90:395/420 of Q8NBZ7
- G98 (= G10) binding
- F99 (= F11) binding
- V100 (≠ I12) binding
- D119 (≠ E31) binding
- N120 (≠ R32) binding
- F122 (≠ R34) binding
- T123 (≠ V35) binding
- G124 (= G36) binding
- D144 (= D59) binding
- V145 (≠ I60) binding
- L149 (≠ I64) binding
- Y150 (vs. gap) binding
- L159 (= L73) binding
- S161 (= S75) binding
- K177 (≠ Q91) binding
- T178 (≠ S92) binding
- N185 (≠ H99) binding
- G188 (≠ N102) binding
- K191 (= K107) binding
- R192 (≠ S108) binding
- A200 (≠ S116) binding
- E204 (≠ T120) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y142) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K146) binding
- R236 (≠ L147) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y156) binding
- Q248 (= Q159) binding
- E249 (≠ Y160) binding
- T261 (≠ P172) binding
- H267 (≠ R178) binding
- R272 (≠ Q183) binding
- R361 (≠ S274) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
29% identity, 99% coverage: 2:308/310 of query aligns to 5:310/310 of 6dntA
- active site: S120 (≠ G118), S121 (≠ G119), A122 (≠ T120), Y144 (= Y142), K148 (= K146), A187 (= A185)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ T77), S120 (≠ G118), S121 (≠ G119), Y144 (= Y142), F172 (≠ A170), N173 (= N171), A187 (= A185), V188 (vs. gap), K191 (≠ V188), V203 (≠ E200), I204 (= I201), Y205 (≠ W202), Q210 (≠ I207), R212 (= R209), I246 (≠ L244), R269 (= R267), D272 (= D270)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D33 (≠ E31), N34 (≠ R32), L35 (≠ A33), S36 (≠ R34), S37 (≠ V35), G38 (= G36), D57 (= D53), L58 (= L54), L76 (= L73), A77 (≠ V74), A78 (≠ S75), A80 (≠ T77), S118 (= S116), S119 (= S117), Y144 (= Y142), K148 (= K146), Y171 (≠ V169), V174 (≠ P172)
- binding zinc ion: E209 (≠ T206), H275 (≠ A273)
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
32% identity, 96% coverage: 3:300/310 of query aligns to 2:280/290 of 3eheA
- active site: T111 (≠ S117), S112 (≠ G118), T113 (= T120), Y135 (= Y142), K139 (= K146)
- binding nicotinamide-adenine-dinucleotide: G6 (= G7), G9 (= G10), F10 (= F11), I11 (= I12), D29 (≠ E31), N30 (≠ R32), L31 (≠ A33), S32 (≠ R34), S33 (≠ V35), G34 (= G36), D49 (= D53), L50 (= L54), I68 (≠ L73), A69 (≠ V74), A70 (≠ S75), T109 (≠ I115), Y135 (= Y142), K139 (= K146), F162 (≠ V169), A163 (= A170), N164 (= N171), V165 (≠ P172)
Query Sequence
>H281DRAFT_04843 FitnessBrowser__Burk376:H281DRAFT_04843
MRITVFGGGGFIGSTIVDRLLRDGHEICVFERARVGPYRRFDNGEDVRWMTGDLMSVHDI
TEAIDSTDIVVHLVSTTLPKSSNDDPIYDVQSNLVATLHLLNAMVAKSVKKIVFISSGGT
VYGDPIYLPVDEKHPTNPKVSYGITKLAIEKYLLLYQYQYGIKANILRVANPYGERQRVE
TAQGAIAVFLDKALRRRPIEIWGDGTITRDYLYIGDVAEAFARAVQYDGTESVFNVSSGY
GTSLNEIVGKIEAILGHPIERSYRPGRPFDVPASVLDNTLAKRELEWHPKVDLDAGIKMT
AAWLRAQIHE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory