SitesBLAST
Comparing H281DRAFT_04849 FitnessBrowser__Burk376:H281DRAFT_04849 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
23% identity, 98% coverage: 4:316/318 of query aligns to 3:311/313 of 6bwlA
- active site: T122 (≠ S117), C123 (≠ I118), M124 (≠ K119), Y147 (= Y142), K151 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), L33 (≠ R34), N35 (≠ G36), S36 (≠ N37), D57 (≠ S49), I58 (≠ T50), L79 (= L71), A80 (= A72), A81 (= A73), I83 (≠ V75), M120 (≠ V115), K151 (= K146), N176 (≠ L171), T177 (≠ V172)
- binding uridine-5'-diphosphate: N176 (≠ L171), G189 (vs. gap), V190 (vs. gap), N205 (≠ P195), I206 (≠ L196), Y207 (vs. gap), Q212 (≠ A201), R214 (= R203), I250 (≠ A236), E275 (≠ R276)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
24% identity, 99% coverage: 3:317/318 of query aligns to 2:307/309 of 4zrnA
- active site: T117 (≠ S117), G119 (≠ K119), A120 (= A120), Y143 (= Y142), K147 (= K146), Y181 (vs. gap), G185 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), S34 (= S35), S35 (≠ G36), G36 (≠ N37), S51 (= S49), I52 (≠ T50), L73 (= L71), A74 (= A72), A75 (= A73), T92 (= T87), S115 (≠ V115), S116 (= S116), Y143 (= Y142), K147 (= K146), Y170 (≠ P169), V173 (= V172)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S117), G119 (≠ K119), A120 (= A120), Y143 (= Y142), N172 (≠ L171), G185 (vs. gap), V186 (= V177), H201 (≠ P195), F203 (vs. gap), Y208 (≠ A201), R210 (= R203), V244 (= V239), R267 (= R276), D270 (≠ R279)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
24% identity, 99% coverage: 1:314/318 of query aligns to 3:337/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (≠ V13), D36 (vs. gap), A37 (vs. gap), L38 (≠ V32), T39 (≠ R33), G42 (= G36), D62 (= D51), I63 (≠ Y52), L84 (= L71), A85 (= A72), A86 (= A73), T103 (= T92), S143 (= S116), T144 (≠ S117), Y169 (= Y142), K173 (= K146), C196 (≠ P169)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
27% identity, 79% coverage: 64:314/318 of query aligns to 73:306/329 of 2hunA
- active site: T125 (≠ S117), D126 (≠ I118), E127 (≠ K119), Y149 (= Y142), K153 (= K146)
- binding nicotinamide-adenine-dinucleotide: L80 (= L71), A81 (= A72), A82 (= A73), S99 (≠ T92), T125 (≠ S117), K153 (= K146), C176 (≠ P169), T177 (≠ P170), N178 (≠ L171), N179 (≠ V172)
Sites not aligning to the query:
8b9zP Drosophila melanogaster complex i in the active state (dm1) (see paper)
26% identity, 78% coverage: 5:252/318 of query aligns to 28:266/377 of 8b9zP
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T33 (≠ N10), G34 (= G11), F35 (= F12), V36 (= V13), R56 (≠ S35), L81 (≠ H57), L100 (≠ V77), V101 (≠ M78), G102 (≠ H79), R103 (≠ D80), F110 (≠ T87), W158 (vs. gap), K162 (≠ A149), I184 (≠ V172), R190 (= R178)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
27% identity, 98% coverage: 4:315/318 of query aligns to 3:308/311 of 2p5uA
- active site: T117 (≠ S117), G119 (≠ K119), A120 (= A120), Y143 (= Y142), K147 (= K146), H181 (= H176), G185 (≠ N180)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), A34 (vs. gap), T35 (≠ V32), G36 (≠ R33), D51 (≠ A48), L52 (≠ S49), Q73 (≠ L71), A74 (= A72), A75 (= A73), A77 (≠ V75), S116 (= S116), Y143 (= Y142), K147 (= K146), V173 (= V172)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
22% identity, 99% coverage: 4:318/318 of query aligns to 4:319/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (≠ V13), D32 (= D40), N33 (≠ G41), N35 (≠ T43), Y38 (≠ V46), K43 (vs. gap), D61 (vs. gap), L62 (vs. gap), L83 (= L71), A84 (= A72), A85 (= A73), A118 (≠ V115), Y145 (= Y142), K149 (= K146), F172 (≠ P169), F173 (≠ P170), T174 (≠ L171), V175 (= V172), R181 (= R178)
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 79% coverage: 65:314/318 of query aligns to 86:358/439 of Q9FX01
- T131 (≠ V115) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (= S117) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ K119) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y142) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K146) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
- R320 (= R276) mutation to I: Normal activity.
- R328 (≠ L284) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
Sites not aligning to the query:
- 41 Essential for the 3betaHSD/D activity; D→V: Lost activity.
- 72 Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
22% identity, 99% coverage: 4:318/318 of query aligns to 4:303/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (≠ V13), D32 (= D40), N33 (≠ G41), N35 (≠ T43), Y38 (≠ V46), K43 (vs. gap), D61 (vs. gap), L62 (vs. gap), L83 (= L71), A84 (= A72), A85 (= A73), A123 (≠ V115), Y150 (= Y142), K154 (= K146), F177 (≠ P169), V180 (= V172), R186 (= R178), M189 (≠ F181)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
28% identity, 80% coverage: 4:256/318 of query aligns to 4:265/308 of 6wj9B
- active site: A119 (≠ S117), A120 (≠ I118), A121 (≠ K119), F144 (≠ Y142), K148 (= K146)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (≠ V13), D32 (vs. gap), D33 (vs. gap), S35 (vs. gap), T36 (≠ V32), G37 (≠ R33), D55 (= D51), A56 (≠ Y52), L75 (= L71), A76 (= A72), A77 (= A73), S94 (≠ T92), A117 (≠ V115), A119 (≠ S117), F144 (≠ Y142), K148 (= K146), F171 (≠ P169), F172 (≠ P170), I174 (≠ V172)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ M78), N173 (≠ L171), G187 (≠ N180), V188 (≠ F181), F192 (≠ M185), T203 (≠ P195), L204 (= L196), F205 (≠ G197), R212 (= R203), L248 (≠ V239)
Sites not aligning to the query:
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 99% coverage: 1:314/318 of query aligns to 1:331/355 of P27830
- FI 12:13 (≠ FV 12:13) binding
- DKLT 33:36 (≠ GLVR 30:33) binding
- DI 59:60 (≠ DA 47:48) binding
- T100 (= T92) binding
- D135 (≠ I118) active site, Proton donor
- E136 (≠ K119) active site, Proton acceptor
- Y160 (= Y142) active site, Proton acceptor
- YSASK 160:164 (≠ YGRSK 142:146) binding
- N190 (≠ V172) binding
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
28% identity, 80% coverage: 4:256/318 of query aligns to 3:264/307 of 6wjaA
- active site: A118 (≠ S117), A119 (≠ I118), A120 (≠ K119), F143 (≠ Y142), K147 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (vs. gap), D32 (vs. gap), S34 (vs. gap), T35 (≠ V32), G36 (≠ R33), A55 (≠ Y52), L74 (= L71), A75 (= A72), A76 (= A73), S93 (≠ T92), F143 (≠ Y142), K147 (= K146), F170 (≠ P169), F171 (≠ P170), I173 (≠ V172)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ M78), A120 (≠ K119), N172 (≠ L171), G186 (≠ N180), V187 (≠ F181), F191 (≠ M185), T202 (≠ P195), F204 (≠ G197), R211 (= R203), L247 (≠ V239)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
30% identity, 79% coverage: 66:317/318 of query aligns to 78:314/322 of 1r6dA
- active site: T127 (≠ S117), N128 (≠ I118), Q129 (≠ K119), Y151 (= Y142), K155 (= K146)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ V75), H88 (= H76), T127 (≠ S117), N128 (≠ I118), Q129 (≠ K119), Y151 (= Y142), N180 (≠ L171), K190 (≠ F181), L191 (= L182), P206 (= P195), Y208 (≠ G197), R215 (= R203), N250 (≠ V239), R274 (≠ L270), H277 (≠ Q273), Y281 (≠ L284)
- binding nicotinamide-adenine-dinucleotide: F83 (≠ L71), A84 (= A72), A85 (= A73), S87 (≠ V75), T102 (= T92), V125 (= V115), S126 (= S116), Y151 (= Y142), K155 (= K146), N181 (≠ V172)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 37, 38, 39, 40, 42, 43, 63, 64
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
31% identity, 54% coverage: 5:175/318 of query aligns to 4:179/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), T35 (≠ G36), G36 (≠ N37), D56 (vs. gap), I57 (vs. gap), L77 (= L71), A78 (= A72), A79 (= A73), I81 (≠ V75), V96 (≠ T92), T119 (≠ V115), Y146 (= Y142), K150 (= K146), P173 (= P169), A174 (≠ P170), N175 (≠ L171), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
31% identity, 54% coverage: 5:175/318 of query aligns to 4:179/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), A34 (≠ S35), T35 (≠ G36), G36 (≠ N37), D56 (vs. gap), I57 (vs. gap), L77 (= L71), A78 (= A72), A79 (= A73), I81 (≠ V75), T119 (≠ V115), Y146 (= Y142), K150 (= K146), P173 (= P169), A174 (≠ P170), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
- binding galactose-uridine-5'-diphosphate: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
- binding uridine-5'-diphosphate-glucose: 187, 188, 189, 193, 204, 206, 211, 213, 248, 271
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
31% identity, 54% coverage: 5:175/318 of query aligns to 4:179/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (≠ V13), D31 (≠ V32), N32 (≠ R33), T35 (≠ G36), G36 (≠ N37), D56 (vs. gap), I57 (vs. gap), L77 (= L71), A78 (= A72), A79 (= A73), I81 (≠ V75), T119 (≠ V115), Y146 (= Y142), K150 (= K146), P173 (= P169), N175 (≠ L171), V176 (= V172)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ V75), R84 (≠ M78), S121 (= S117), G123 (≠ K119), S124 (≠ A120), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
30% identity, 79% coverage: 66:317/318 of query aligns to 78:314/322 of 1r66A
- active site: T127 (≠ S117), D128 (≠ I118), E129 (≠ K119), Y151 (= Y142), K155 (= K146)
- binding nicotinamide-adenine-dinucleotide: F83 (≠ L71), A84 (= A72), A85 (= A73), S87 (≠ V75), T102 (= T92), V125 (= V115), S126 (= S116), Y151 (= Y142), K155 (= K146), N181 (≠ V172)
- binding thymidine-5'-diphosphate: H88 (= H76), E129 (≠ K119), N180 (≠ L171), K190 (≠ F181), L191 (= L182), P206 (= P195), Y208 (≠ G197), R215 (= R203), N250 (≠ V239), R274 (≠ L270), H277 (≠ Q273)
Sites not aligning to the query:
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
22% identity, 98% coverage: 4:316/318 of query aligns to 4:306/312 of 2b69A
- active site: T115 (≠ S117), S116 (≠ I118), E117 (≠ K119), Y144 (= Y142), K148 (= K146), R185 (= R183)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (= V13), D32 (≠ V32), N33 (≠ R33), T36 (≠ G36), G37 (≠ N37), D57 (≠ N58), V58 (vs. gap), L72 (= L71), A73 (= A72), S74 (≠ A73), A76 (= A82), T91 (= T92), T115 (≠ S117), Y144 (= Y142), K148 (= K146), I171 (≠ P169), N173 (≠ L171), R185 (= R183)
- binding uridine-5'-diphosphate: P61 (= P60), L62 (≠ A61), Y63 (≠ N62), P78 (≠ D84), N98 (≠ R99), G101 (≠ A102), L102 (≠ T103), K104 (≠ R105), R105 (= R106), Y158 (≠ M156), N173 (≠ L171), R185 (= R183), V186 (≠ L184), N189 (vs. gap), T201 (≠ P195), Y203 (≠ G197), Q208 (≠ R202), R210 (= R203), I244 (≠ V239), D270 (≠ R265)
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
36% identity, 52% coverage: 4:168/318 of query aligns to 2:158/321 of 4id9A
- active site: S106 (= S117), Y132 (= Y142), K136 (= K146)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), R10 (≠ F12), V11 (= V13), D30 (vs. gap), L31 (≠ V32), R32 (= R33), S44 (≠ A48), L45 (≠ S49), L64 (= L71), A66 (= A73), V81 (≠ T92), S106 (= S117), Y132 (= Y142), K136 (= K146)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
36% identity, 52% coverage: 4:168/318 of query aligns to 3:159/328 of 4id9B
- active site: S107 (= S117), Y133 (= Y142), K137 (= K146)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), R11 (≠ F12), V12 (= V13), D31 (vs. gap), L32 (≠ V32), S45 (≠ A48), L46 (≠ S49), L65 (= L71), A67 (= A73), V82 (≠ T92), Y133 (= Y142), K137 (= K146)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_04849 FitnessBrowser__Burk376:H281DRAFT_04849
MSHVVVSGANGFVGRALCRALLGAGHCVTGLVRRSGNCVDGVTEWVDASTDYHGIAHNWP
ANMKADCVVHLAARVHVMHDTAADPETAFRATNVDGTLRLAATARRHGVPRFVFVSSIKA
VAEQSRGQSLCENDSPRPEDAYGRSKRAAEDALIRMGDDTGLEVVIVRPPLVYGPHVRAN
FLRLMDAVWRGVPLPLGGADARRSMVYVGNLADALVHCATDARAARQCFHVADSDAPTVA
ELVRSLGRHLGKPVRLLPVPAAWLRMAARLTGQSSRVDRLLGSLQVDTSHIRDVLGWHPP
FSTDEGLAATADWYRSTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory