Comparing H281DRAFT_05870 FitnessBrowser__Burk376:H281DRAFT_05870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
39% identity, 80% coverage: 45:271/283 of query aligns to 1:228/229 of 5t0wA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
36% identity, 78% coverage: 53:272/283 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
36% identity, 78% coverage: 53:272/283 of query aligns to 3:226/226 of 4zv1A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
36% identity, 80% coverage: 47:271/283 of query aligns to 3:227/229 of 6svfA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
37% identity, 80% coverage: 53:277/283 of query aligns to 3:231/234 of 3k4uE
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
33% identity, 73% coverage: 44:251/283 of query aligns to 1:211/247 of 2yjpA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
30% identity, 82% coverage: 45:276/283 of query aligns to 5:243/251 of 1xt8B
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
34% identity, 72% coverage: 67:271/283 of query aligns to 26:234/243 of 5eyfB
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
29% identity, 77% coverage: 54:271/283 of query aligns to 1:222/224 of 4ymxA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
28% identity, 78% coverage: 53:273/283 of query aligns to 50:273/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
28% identity, 78% coverage: 53:273/283 of query aligns to 50:273/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
28% identity, 78% coverage: 53:273/283 of query aligns to 51:274/288 of 6h2tA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
26% identity, 82% coverage: 46:276/283 of query aligns to 9:239/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
26% identity, 82% coverage: 46:276/283 of query aligns to 9:239/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
26% identity, 82% coverage: 46:276/283 of query aligns to 9:239/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
26% identity, 82% coverage: 46:276/283 of query aligns to 5:235/237 of 3vv5A
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
46% identity, 32% coverage: 47:137/283 of query aligns to 2:92/130 of 7a99B
Sites not aligning to the query:
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
25% identity, 77% coverage: 55:271/283 of query aligns to 7:227/228 of 2y7iA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 77% coverage: 58:276/283 of query aligns to 9:229/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 77% coverage: 58:276/283 of query aligns to 15:235/241 of 2q2aA
>H281DRAFT_05870 FitnessBrowser__Burk376:H281DRAFT_05870
MKLATKGAKAALLFAATAVSGLLALSACTKVATPEQGPAAAAPASTLQAVLQRGTLRVGD
CLTFAPFGFYDKDGNADGYDVDLAKELAKQMGVKLEVVNTTSANRIPNLQTAKVDVVFCN
FTRNLERAKVVEFTSPYVVASEAMLVKKSSGIQSAKDMNGRTIATVKGSTNGDEVRSMGI
PVKIQEYDSSQAAILAVKQGQADAMIEDNNFLAYQAKLDPELTVTNEALVPLEYNAFGVK
AGDQAWLNYLNLFLFNINASKLNAQLYKKWFGVDPRYPLNPQF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory