SitesBLAST
Comparing H281DRAFT_06348 FitnessBrowser__Burk376:H281DRAFT_06348 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
48% identity, 95% coverage: 5:432/452 of query aligns to 10:439/448 of Q51955
- D41 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D39) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G80) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D84) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G87) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R119) mutation to A: Abolishes 4-HBA transport.
- E144 (= E139) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R178) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D316) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ N321) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R379) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R391) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
41% identity, 98% coverage: 4:447/452 of query aligns to 2:447/452 of Q5EXK5
- D82 (= D84) mutation to A: Loss of activity.
- V311 (= V313) mutation to W: Loss of activity.
- D314 (= D316) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
31% identity, 91% coverage: 28:439/452 of query aligns to 19:397/403 of P77589
- E27 (≠ D36) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D84) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ V313) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R317) mutation to D: Lack of 3HPP transport activity.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
29% identity, 80% coverage: 33:395/452 of query aligns to 51:390/444 of Q8NLB7
- D54 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D39) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R85) mutation to A: Loss of transport activity.
- W309 (≠ V313) mutation to V: Loss of transport activity.
- D312 (= D316) mutation to A: Loss of transport activity.
- R313 (= R317) mutation to A: Loss of transport activity.
- I317 (≠ N321) mutation I->H,Y: Loss of transport activity.
- R386 (= R391) mutation to A: Loss of transport activity.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
32% identity, 47% coverage: 64:276/452 of query aligns to 47:263/446 of A0A0H2VG78
- R102 (= R119) mutation to A: Loss of transport activity.
- I105 (≠ T122) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E139) mutation to A: Loss of transport activity.
- Q137 (≠ F154) mutation to A: Loss of transport activity.
- Q250 (≠ T265) mutation to A: Loss of transport activity.
- Q251 (≠ Y266) mutation to A: Loss of transport activity.
- N256 (vs. gap) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 357 W→A: Loss of transport activity.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 46% coverage: 6:211/452 of query aligns to 149:366/742 of Q02563
- DMCLS 196:200 (≠ EWGIA 53:57) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 178:178, 0% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
30% identity, 36% coverage: 49:212/452 of query aligns to 127:289/550 of Q9NSA0
- G241 (= G160) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
- 305 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- 400 mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- 469 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
22% identity, 68% coverage: 22:330/452 of query aligns to 14:310/430 of P0AA76
- Y29 (≠ G37) binding
- D31 (= D39) mutation to N: Loss of galactonate transport activity.
- R32 (≠ T40) binding
- Y64 (≠ L72) binding
- E118 (≠ L126) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
24% identity, 45% coverage: 6:208/452 of query aligns to 135:349/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 68% coverage: 22:330/452 of query aligns to 3:291/409 of 6e9nA
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
25% identity, 78% coverage: 34:384/452 of query aligns to 18:405/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
25% identity, 78% coverage: 34:384/452 of query aligns to 18:405/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
25% identity, 78% coverage: 34:384/452 of query aligns to 18:405/475 of 4gbyA
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
25% identity, 78% coverage: 34:384/452 of query aligns to 22:409/491 of P0AGF4
- F24 (≠ D36) mutation to A: Decreases xylose transport.
- G83 (= G87) mutation to A: Abolishes xylose transport.
- R133 (= R119) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E139) mutation to A: Abolishes xylose transport.
- R160 (= R146) mutation to A: Abolishes xylose transport.
- Q168 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ T265) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ TY 265:266) binding
- Q289 (≠ Y266) mutation to A: Strongly decreases xylose transport.
- N294 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ F273) mutation to A: Abolishes xylose transport.
- N325 (≠ G305) mutation to A: No effect on xylose transport.
- G340 (≠ N319) mutation to A: Abolishes xylose transport.
- R341 (≠ A320) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ M366) binding ; mutation to A: Abolishes xylose transport.
- E397 (≠ A371) mutation to A: Abolishes xylose transport.
- R404 (= R379) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
24% identity, 45% coverage: 6:208/452 of query aligns to 135:349/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 40% coverage: 22:200/452 of query aligns to 6:185/393 of 6e9oA
Sites not aligning to the query:
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
30% identity, 38% coverage: 71:241/452 of query aligns to 156:327/562 of O57379
Sites not aligning to the query:
- 34 H→I: Reduced transport activity.
- 394 K→A: Reduced transport activity.
- 478 R→D: Reduced transport activity.
Q497L9 Solute carrier family 22 member 14 from Mus musculus (Mouse) (see paper)
28% identity, 39% coverage: 35:211/452 of query aligns to 148:328/629 of Q497L9
- H275 (≠ F154) mutation to A: Strongly reduced riboflavin transport; when associated with 391-A--A-394.
Sites not aligning to the query:
- 391:394 SYIS→AYIA: Strongly reduced riboflavin transport; when associated with A-275.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
27% identity, 37% coverage: 71:236/452 of query aligns to 158:321/554 of O15245
- L160 (≠ A73) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- S189 (≠ A102) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A133) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ M153) mutation to F: Decreased TEA uptake.
- P283 (= P200) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (= R204) to G: in dbSNP:rs4646278
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- 361 Y→F: Decreased TEA uptake.
- 376 Y→F: Decreased TEA uptake.
- 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- 440 M → I: in dbSNP:rs35956182
- 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
26% identity, 41% coverage: 49:232/452 of query aligns to 101:282/497 of 8bw7A
Sites not aligning to the query:
Query Sequence
>H281DRAFT_06348 FitnessBrowser__Burk376:H281DRAFT_06348
MNRSNAVNVQTFLNEHPFSPFQWLVFFMCFVIVLLDGFDTAAIGFIAPSLLAEWGIAKPA
LAPVLSAALFGLACGALVSGPLSDRLGRRGMLLGSVLLFGAACLGSAFSTSIEYLTVLRF
ITGVGLGAAMPNAVTMMGEYCPDSRRATVINLMFCGFPLGAAFGGFLAAWMIPHFGWRSV
LMLGGIAPLLLLVLLVIKMPESVRYMVANNQPVARIRTALSRISSEAAQADSFMMTETAP
QTGGKGAGVVLSRAYIVGSLMLWITYFMGLVIFYASINWMPILLKDAGLTPQRATLISAL
FPLGGVGAVVCGVLMDRFNANRIIAACYALTAVSVYFIGQAVGNVGALVFIVFVAGVLMN
TAQSSMPALAAAFYPTQGRGTGVAWMLGIGRFGGIAGSFLVAELARRHFTFAGIFATIAV
AGVIACIALLIKQAARPHVANASVPKAESFGH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory