Comparing H281DRAFT_06355 FitnessBrowser__Burk376:H281DRAFT_06355 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
G2IQQ5 2-keto-4-carboxy-3-hexenedioate hydratase; KCH hydratase; EC 4.2.1.- from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
64% identity, 99% coverage: 1:343/346 of query aligns to 3:340/341 of G2IQQ5
6dxsA Crystal structure of the ligj hydratase e284q mutant substrate complex with (3z)-2-keto-4-carboxy-3-hexenedioate (see paper)
63% identity, 100% coverage: 1:345/346 of query aligns to 2:341/342 of 6dxsA
6dxqA Crystal structure of the ligj hydratase product complex with 4- carboxy-4-hydroxy-2-oxoadipate (see paper)
64% identity, 99% coverage: 2:343/346 of query aligns to 1:337/338 of 6dxqA
2gwgA Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
59% identity, 100% coverage: 1:345/346 of query aligns to 1:327/329 of 2gwgA
6e6iA Crystal structure of 4-methyl hopda bound to ligy from sphingobium sp. Strain syk-6
37% identity, 95% coverage: 1:328/346 of query aligns to 1:328/332 of 6e6iA
5vn5C Crystal structure of ligy from sphingobium sp. Strain syk-6 (see paper)
37% identity, 95% coverage: 1:328/346 of query aligns to 1:328/334 of 5vn5C
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
27% identity, 68% coverage: 91:326/346 of query aligns to 88:296/301 of 7pwyC
Sites not aligning to the query:
4qroA Crystal structure of dihydroxybenzoic acid decarbboxylase bpro_2061 (target efi-500288) from polaromonas sp. Js666 with bound manganese and an inhibitor, 2-nitroresorcinol
26% identity, 83% coverage: 48:333/346 of query aligns to 39:326/332 of 4qroA
Sites not aligning to the query:
Q12BV1 Gamma-resorcylate decarboxylase; Gamma-RSD; 2,6-dihydroxybenzoate decarboxylase; 2,6-DHBD; EC 4.1.1.103 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
26% identity, 83% coverage: 48:333/346 of query aligns to 39:326/326 of Q12BV1
Sites not aligning to the query:
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
25% identity, 71% coverage: 91:336/346 of query aligns to 98:336/336 of Q8TDX5
Sites not aligning to the query:
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
26% identity, 68% coverage: 91:326/346 of query aligns to 98:326/332 of 4ih3A
Sites not aligning to the query:
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
26% identity, 68% coverage: 91:326/346 of query aligns to 98:326/332 of 2wm1A
Sites not aligning to the query:
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
26% identity, 68% coverage: 91:326/346 of query aligns to 98:326/335 of 4ofcA
Sites not aligning to the query:
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
26% identity, 68% coverage: 91:326/346 of query aligns to 97:325/334 of 7pwyA
Sites not aligning to the query:
4infA Crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium
25% identity, 77% coverage: 60:324/346 of query aligns to 81:345/351 of 4infA
Sites not aligning to the query:
4qrnA High-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid
25% identity, 77% coverage: 60:324/346 of query aligns to 82:346/352 of 4qrnA
Sites not aligning to the query:
7a19A 2,3-dihydroxybenzoate decarboxylase of aspergillus oryzae (see paper)
23% identity, 82% coverage: 44:328/346 of query aligns to 36:329/339 of 7a19A
Sites not aligning to the query:
7wjrA Crystal structure of dihydroxybenzoate decarboxylase mutant a63s from aspergillus oryzae in complex with catechol
23% identity, 82% coverage: 44:328/346 of query aligns to 36:329/339 of 7wjrA
Sites not aligning to the query:
8h41B Crystal structure of a decarboxylase from trichosporon moniliiforme in complex with o-nitrophenol
21% identity, 96% coverage: 6:338/346 of query aligns to 5:356/357 of 8h41B
2dvxA Crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde
26% identity, 53% coverage: 48:232/346 of query aligns to 39:229/325 of 2dvxA
Sites not aligning to the query:
>H281DRAFT_06355 FitnessBrowser__Burk376:H281DRAFT_06355
MIIDCHGHYTTSPPQHEAWRTQQIAALKDGHTPPARPNISDDEIRESIETGQLRIQRERG
TDLTIFSPRAAGMGHHLATAQANAQWSRECNDLVHRVCSLFPRNFVGVCQLPQAPGVPPA
NCIDELRRCVEELGFIGCNLNPDPSGGHWSGLPLTDRSWYPLYEAMVELDVPAMIHVSSS
CNPNFHATGAHYINGDTSAFMQLLTGDLFADFPTLRFIIPHGGGAVPYHWGRYRGLAQDM
KRPLLRDYLLKNVFFDTCVYHQPGAELLAKVIPVENILFASETIGAVQGVDPETGHHYDD
TRRYIDAIEWLSDAERQRIYEDNARAVYPRLSRQLDRQLAAQGAIV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory