Comparing HSERO_RS00870 FitnessBrowser__HerbieS:HSERO_RS00870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
37% identity, 90% coverage: 30:370/378 of query aligns to 3:338/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
37% identity, 90% coverage: 30:370/378 of query aligns to 3:338/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
37% identity, 90% coverage: 30:370/378 of query aligns to 3:338/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
37% identity, 90% coverage: 30:370/378 of query aligns to 3:338/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
37% identity, 90% coverage: 30:370/378 of query aligns to 3:338/348 of 3ipcA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
31% identity, 92% coverage: 30:375/378 of query aligns to 3:345/345 of 4n0qB
1uskA L-leucine-binding protein with leucine bound (see paper)
30% identity, 90% coverage: 30:368/378 of query aligns to 3:337/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
30% identity, 90% coverage: 30:368/378 of query aligns to 3:337/345 of 1usiA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
28% identity, 90% coverage: 30:368/378 of query aligns to 3:335/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
28% identity, 90% coverage: 30:368/378 of query aligns to 3:335/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
28% identity, 90% coverage: 30:368/378 of query aligns to 3:335/344 of 1z16A
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
28% identity, 84% coverage: 52:370/378 of query aligns to 21:331/336 of 4mlcA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
31% identity, 87% coverage: 28:356/378 of query aligns to 1:325/348 of 4gnrA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
28% identity, 84% coverage: 52:370/378 of query aligns to 21:330/335 of 4q6bA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
29% identity, 89% coverage: 29:363/378 of query aligns to 1:331/350 of 3td9A
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
29% identity, 90% coverage: 29:367/378 of query aligns to 3:363/376 of 4q6wA
4eygB Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with vanillic acid (see paper)
27% identity, 78% coverage: 31:324/378 of query aligns to 5:295/364 of 4eygB
4dqdA The crystal structure of a transporter in complex with 3-phenylpyruvic acid (see paper)
22% identity, 78% coverage: 30:325/378 of query aligns to 3:300/361 of 4dqdA
3sg0A The crystal structure of an extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 (see paper)
22% identity, 78% coverage: 30:325/378 of query aligns to 4:301/361 of 3sg0A
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
23% identity, 85% coverage: 30:350/378 of query aligns to 3:325/364 of 4rdcA
Sites not aligning to the query:
>HSERO_RS00870 FitnessBrowser__HerbieS:HSERO_RS00870
MFKRVSGLNIIAASLALIPAFAMAQETQVVKIGFSSPLTGPQASAGKDNQGGLMMAIERL
NAQPITVGGKKIKFDVIAEDDQADPKSGVAVAQKLADQGVKAIVGPYNSGVTIPASRVYN
DAGIVVATVASNPKITQQGFATLFRVAASDSQLGGKMALYAAKELKFKRVAVIDDRTAYG
QGLAQEFIKVAKANGIDVVSTDFTNDKATDFTAILTSIKGKKPDAVFLGGYAPQGGPIKR
QMKQLGVDVPLMGGDGICSPEMGRLGGDAIGESVYCTQGGTMLDKAKEGKVFSDEYQKKY
NRPAETYAVSFYDGMMLIAQAMKQANSVDPKQFGPALAKISYKGVAGQYDFDANHDLKQS
PVTVYRFKDGLPVPLTSY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory