SitesBLAST
Comparing HSERO_RS01485 FitnessBrowser__HerbieS:HSERO_RS01485 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
55% identity, 99% coverage: 4:280/280 of query aligns to 5:281/281 of 5c7hA
- active site: D52 (= D51), Y57 (= Y56), K82 (= K81), H115 (= H114)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G21), T23 (= T22), W24 (= W23), D52 (= D51), Y57 (= Y56), H115 (= H114), Q167 (= Q166), Y195 (= Y194), S196 (= S195), P197 (= P196), L198 (≠ I197), E200 (≠ Q199), L204 (= L203), A221 (= A220), I237 (= I236), P238 (= P237), K239 (= K238), T240 (≠ A239), R245 (≠ H244), E248 (≠ A247), N249 (= N248), I281 (≠ L280)
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
55% identity, 99% coverage: 4:280/280 of query aligns to 5:281/281 of 4pmjA
- active site: D52 (= D51), Y57 (= Y56), K82 (= K81), H115 (= H114)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G21), T23 (= T22), W24 (= W23), D52 (= D51), H115 (= H114), Q167 (= Q166), Y195 (= Y194), S196 (= S195), P197 (= P196), L198 (≠ I197), E200 (≠ Q199), L204 (= L203), A221 (= A220), I237 (= I236), P238 (= P237), K239 (= K238), T240 (≠ A239), G241 (≠ A240), R245 (≠ H244), E248 (≠ A247), N249 (= N248)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
54% identity, 98% coverage: 8:280/280 of query aligns to 4:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G21), T20 (= T22), W21 (= W23), D49 (= D51), Y54 (= Y56), N142 (= N144), Q164 (= Q166), Y192 (= Y194), C193 (≠ S195), P194 (= P196), L195 (≠ I197), Q197 (= Q199), A198 (vs. gap), R200 (= R201), A223 (= A220), I239 (= I236), P240 (= P237), K241 (= K238), A242 (= A239), A243 (= A240), S244 (≠ D241), H247 (= H244), N251 (= N248)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
54% identity, 98% coverage: 8:280/280 of query aligns to 5:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G21), T21 (= T22), W22 (= W23), D50 (= D51), Y55 (= Y56), H113 (= H114), N143 (= N144), Q165 (= Q166), Y193 (= Y194), C194 (≠ S195), P195 (= P196), L196 (≠ I197), Q198 (= Q199), A199 (vs. gap), A224 (= A220), I240 (= I236), P241 (= P237), K242 (= K238), A243 (= A239), A244 (= A240), S245 (≠ D241), H248 (= H244), N252 (= N248)
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
39% identity, 91% coverage: 10:265/280 of query aligns to 8:271/274 of 5danA
- active site: D53 (= D51), Y58 (= Y56), K84 (= K81), H117 (= H114)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G21), T20 (= T22), W21 (= W23), D53 (= D51), Y58 (= Y56), H117 (= H114), Q169 (= Q166), Y198 (= Y194), S199 (= S195), P200 (= P196), L201 (≠ I197), R203 (≠ Q199), Y226 (≠ A220), I242 (= I236), P243 (= P237), K244 (= K238), G246 (≠ A240), R247 (≠ D241), H250 (= H244), E253 (≠ A247), N254 (= N248)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
39% identity, 91% coverage: 10:265/280 of query aligns to 9:272/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W23), Y59 (= Y56), W87 (≠ L83), H118 (= H114), R204 (≠ Q199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G21), T21 (= T22), W22 (= W23), Y59 (= Y56), H118 (= H114), N149 (= N144), Q170 (= Q166), Y199 (= Y194), S200 (= S195), P201 (= P196), L202 (≠ I197), R204 (≠ Q199), T205 (≠ G200), Y227 (≠ A220), I243 (= I236), P244 (= P237), K245 (= K238), G247 (≠ A240), R248 (≠ D241), H251 (= H244), E254 (≠ A247), N255 (= N248)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
39% identity, 91% coverage: 10:265/280 of query aligns to 9:272/275 of 6kikA
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 92% coverage: 5:261/280 of query aligns to 3:252/275 of A0QV10
Sites not aligning to the query:
- 262 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
31% identity, 93% coverage: 7:265/280 of query aligns to 12:262/281 of 1vbjA
- active site: D52 (= D51), Y57 (= Y56), K82 (= K81), H115 (= H114)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G21), M27 (≠ T22), W28 (= W23), D52 (= D51), Y57 (= Y56), H115 (= H114), N145 (= N144), Q166 (= Q166), W192 (≠ Y194), S193 (= S195), P194 (= P196), L195 (≠ I197), Q197 (= Q199), G198 (= G200), V201 (≠ L203), A218 (= A220), I233 (= I236), K235 (= K238), S236 (≠ A239), G237 (≠ A240), R241 (≠ H244), E244 (≠ A247), N245 (= N248)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
31% identity, 93% coverage: 7:265/280 of query aligns to 7:257/276 of Q9GV41
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
32% identity, 93% coverage: 7:266/280 of query aligns to 4:258/277 of 4fziA
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
32% identity, 93% coverage: 7:266/280 of query aligns to 15:269/288 of 4gieA
- active site: D55 (= D51), Y60 (= Y56), K85 (= K81), H118 (= H114)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G21), W31 (= W23), D55 (= D51), Y60 (= Y56), H118 (= H114), W119 (= W115), N148 (= N144), Q169 (= Q166), W195 (≠ Y194), S196 (= S195), P197 (= P196), L198 (≠ I197), S200 (vs. gap), L207 (= L203), A224 (= A220), I239 (= I236), P240 (= P237), K241 (= K238), S242 (≠ A239), R247 (≠ H244), E250 (≠ A247), N251 (= N248)
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
31% identity, 94% coverage: 3:265/280 of query aligns to 1:256/274 of 2wzmA
- active site: D44 (= D51), Y49 (= Y56), K74 (= K81), H107 (= H114)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y194), G187 (≠ S195), P188 (= P196), L189 (≠ I197), G190 (≠ E198), V191 (≠ Q199), G192 (= G200), L195 (= L203), A212 (= A220), I227 (= I236), R229 (≠ K238), S230 (≠ A239), R235 (≠ H244), N239 (= N248)
Sites not aligning to the query:
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 94% coverage: 3:265/280 of query aligns to 10:265/283 of A0QV09
- G196 (≠ S195) binding
- L198 (≠ I197) binding
- V200 (≠ Q199) binding
- I236 (= I236) binding
- R238 (≠ K238) binding
- S239 (≠ A239) binding
- A240 (= A240) binding
- R244 (≠ H244) binding
- S247 (≠ A247) binding
- N248 (= N248) binding
Sites not aligning to the query:
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
33% identity, 91% coverage: 12:267/280 of query aligns to 10:276/287 of 3v0sA
- active site: D45 (= D51), Y50 (= Y56), G87 (= G91), H119 (= H114)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (= S195), P199 (= P196), I200 (= I197), G201 (≠ E198), L204 (vs. gap), P246 (= P237), G247 (≠ K238), T248 (≠ A239), T249 (≠ A240), N253 (≠ H244), N256 (≠ A247), N257 (= N248)
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
31% identity, 93% coverage: 6:265/280 of query aligns to 7:266/283 of 4g5dA
- active site: D48 (= D51), Y53 (= Y56), K78 (= K81), H111 (= H114)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G21), V23 (≠ T22), W24 (= W23), D48 (= D51), Y53 (= Y56), H111 (= H114), S148 (= S143), N149 (= N144), Q170 (= Q166), W196 (≠ Y194), S197 (= S195), P198 (= P196), L199 (≠ I197), Q201 (= Q199), G202 (= G200), L205 (= L203), I237 (= I236), P238 (= P237), K239 (= K238), S240 (≠ A239), V241 (≠ A240), H242 (≠ D241), R245 (≠ H244), E248 (≠ A247), N249 (= N248)
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
32% identity, 93% coverage: 7:265/280 of query aligns to 8:258/275 of 3d3fA
- active site: D48 (= D51), Y53 (= Y56), K78 (= K81), H111 (= H114)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G21), F24 (≠ W23), D48 (= D51), Y53 (= Y56), H111 (= H114), S140 (= S143), N141 (= N144), Q162 (= Q166), W188 (≠ Y194), S189 (= S195), P190 (= P196), L191 (≠ I197), Q193 (= Q199), L197 (= L203), I229 (= I236), K231 (= K238), S232 (≠ A239), K234 (≠ D241), R237 (≠ H244), E240 (≠ A247), N241 (= N248)
3b3dA B.Subtilis ytbe (see paper)
32% identity, 92% coverage: 8:265/280 of query aligns to 10:263/280 of 3b3dA
1vp5A Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
31% identity, 94% coverage: 4:267/280 of query aligns to 2:264/284 of 1vp5A
- active site: D44 (= D51), Y49 (= Y56), K78 (= K81), H111 (= H114)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G21), V20 (≠ T22), F21 (≠ W23), D44 (= D51), Y49 (= Y56), N140 (= N144), Q161 (= Q166), W187 (≠ Y194), G188 (≠ S195), P189 (= P196), F190 (≠ I197), E192 (≠ Q199), F198 (≠ L203), A215 (= A220), I230 (= I236), K232 (= K238), T233 (≠ A239), V234 (≠ A240), R238 (≠ H244), E241 (≠ A247), N242 (= N248)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
29% identity, 83% coverage: 36:267/280 of query aligns to 37:308/337 of Q3L181
- D52 (= D51) mutation to A: 99% loss of activity.
- Y57 (= Y56) mutation to A: 99% loss of activity.
- K84 (= K81) mutation to A: Total loss of activity.
- H126 (= H114) mutation to A: 98% loss of activity.
Query Sequence
>HSERO_RS01485 FitnessBrowser__HerbieS:HSERO_RS01485
MQSIPLLSLRNGQSVPILGQGTWNMGESPAQANAEVRALQAGLDLGMSLIDTAEMYAEGG
AERIVAKAIAGRRDQVYLVSKVLPHNASKRGTIAACEASLKRLGTDRIDLYLLHWRGAHP
LAATIEGMETLVSQGKIGGWGVSNFDTDDIDDLLEEPHGEHYLCNQVLYNLSRRGIEYDL
LPQAQQAHIAVMAYSPIEQGRILKHPALTALAQAHRVTPAQIALAWVLRQPGVVAIPKAA
DVAHVQANRASLDISLSAADLKILDEAFAPPRRKQPLAML
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory