Comparing HSERO_RS02190 FitnessBrowser__HerbieS:HSERO_RS02190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
61% identity, 92% coverage: 39:451/451 of query aligns to 3:417/417 of 4ryaA
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
26% identity, 90% coverage: 38:444/451 of query aligns to 6:399/399 of 5iaiA
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
25% identity, 88% coverage: 48:446/451 of query aligns to 14:407/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
25% identity, 88% coverage: 48:446/451 of query aligns to 55:448/450 of Q7LYW7
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
24% identity, 94% coverage: 21:445/451 of query aligns to 17:416/416 of A9CEY9
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
24% identity, 90% coverage: 42:445/451 of query aligns to 9:388/389 of 7ofyA
6dtqA Maltose bound t. Maritima male3 (see paper)
25% identity, 84% coverage: 53:433/451 of query aligns to 18:380/391 of 6dtqA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
24% identity, 90% coverage: 42:445/451 of query aligns to 7:383/384 of 7yzsAAA
7qhvAAA Sulfoquinovosyl binding protein (see paper)
24% identity, 90% coverage: 42:445/451 of query aligns to 8:386/390 of 7qhvAAA
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
25% identity, 90% coverage: 42:445/451 of query aligns to 6:380/382 of 7yzuA
1eljA The crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus (see paper)
26% identity, 68% coverage: 48:354/451 of query aligns to 16:306/380 of 1eljA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 71% coverage: 46:363/451 of query aligns to 13:318/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 71% coverage: 46:363/451 of query aligns to 13:318/388 of 3jzjA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
26% identity, 52% coverage: 104:338/451 of query aligns to 69:303/393 of 5ci5A
Sites not aligning to the query:
5f7vA Abc substrate-binding protein lmo0181 from listeria monocytogenes in complex with cycloalternan (see paper)
24% identity, 87% coverage: 53:444/451 of query aligns to 17:385/388 of 5f7vA
Sites not aligning to the query:
8artB Abc transporter binding protein male from streptomyces scabiei in complex with maltose
32% identity, 31% coverage: 56:194/451 of query aligns to 24:156/393 of 8artB
Sites not aligning to the query:
7ehpA Chitin oligosaccharide binding protein (see paper)
24% identity, 66% coverage: 53:350/451 of query aligns to 20:320/397 of 7ehpA
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
31% identity, 44% coverage: 53:249/451 of query aligns to 19:213/386 of 6preA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
31% identity, 44% coverage: 53:249/451 of query aligns to 18:212/385 of 2i58A
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
25% identity, 66% coverage: 35:331/451 of query aligns to 1:304/406 of 7ehqA
Sites not aligning to the query:
>HSERO_RS02190 FitnessBrowser__HerbieS:HSERO_RS02190
MSKLVRPRAFGFTRVRFTLAAAAISTLFAAGLAQAEPVTLNIASINNPDMIELQKLAPAF
EKANPDIKLRWVTMEESVLRQRLTTDIATNSGQFDLMTIGAYEAPIWAKKGWLAPMTGLP
ADYDEADLIKPVREGLSVDGKLYALPFYAESSMTYYRKDLFEQKKLTMPQRPTWDEIAKL
AAQLHDPAKGVYGICLRGRAGWGENMAIITTMANAWGGRWFDEQWQPQLSSPEWKKSVAF
YVDLMRKYGPPGASSNGFNENLVLFSSGKCGMWVDATVAAGMLYHGKDSKVADKTAFAPS
PMQVTDKGSHWLWIWSLAVPKSSKSQDAAKKFAAWATSKEYINLVAKDSGWALVPPGTRN
STYASAEYKKVSPFSDFVLDAIQTADANKPTVKPVPYTGVQFATIPEFQSIGTVTGQAIA
GALAGKTTSDAALDAAQAQAVRMMRQGRYIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory