SitesBLAST
Comparing HSERO_RS05235 FitnessBrowser__HerbieS:HSERO_RS05235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ip5A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg and d-erythronohydroxamate
72% identity, 99% coverage: 2:423/425 of query aligns to 1:421/421 of 4ip5A
- active site: K217 (= K219), D245 (= D247), N247 (= N249), E271 (= E273), E298 (= E300), D321 (= D323), H348 (= H350), E379 (= E381)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G22), D23 (= D24), Y31 (= Y32), K215 (= K217), K217 (= K219), D245 (= D247), N247 (= N249), E298 (= E300), H348 (= H350)
- binding magnesium ion: D245 (= D247), E271 (= E273), E298 (= E300)
4ip4A Crystal structure of l-fuconate dehydratase from silicibacter sp. Tm1040 liganded with mg
72% identity, 99% coverage: 2:423/425 of query aligns to 1:421/421 of 4ip4A
Q8P3K2 L-fuconate dehydratase; FucD; EC 4.2.1.68 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
57% identity, 100% coverage: 1:423/425 of query aligns to 1:424/441 of Q8P3K2
- GSD 22:24 (= GSD 22:24) binding
- Y32 (= Y32) binding
- K218 (= K217) binding
- K220 (= K219) mutation to A: Inactive.
- D248 (= D247) binding
- N250 (= N249) binding
- E274 (= E273) binding ; binding
- E301 (= E300) binding ; binding
- HAG 351:353 (= HAG 350:352) binding
- E382 (= E381) binding
1yeyC Crystal structure of l-fuconate dehydratase from xanthomonas campestris pv. Campestris str. Atcc 33913
57% identity, 100% coverage: 1:423/425 of query aligns to 1:424/435 of 1yeyC
- active site: T55 (= T54), T190 (= T189), K218 (= K217), K220 (= K219), D248 (= D247), N250 (= N249), E274 (= E273), G300 (= G299), E301 (= E300), D324 (= D323), P350 (= P349), H351 (= H350), A352 (= A351), D368 (= D367), K375 (≠ S374), E382 (= E381)
- binding magnesium ion: D248 (= D247), E274 (= E273), E301 (= E300)
2hxtA Crystal structure of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and d-erythronohydroxamate (see paper)
57% identity, 99% coverage: 4:423/425 of query aligns to 3:423/434 of 2hxtA
- active site: T54 (= T54), T189 (= T189), K217 (= K217), K219 (= K219), D247 (= D247), N249 (= N249), E273 (= E273), G299 (= G299), E300 (= E300), D323 (= D323), P349 (= P349), H350 (= H350), A351 (= A351), D367 (= D367), K374 (≠ S374), E381 (= E381)
- binding (2r,3r)-n,2,3,4-tetrahydroxybutanamide: G21 (= G22), D23 (= D24), Y31 (= Y32), K217 (= K217), K219 (= K219), E300 (= E300), H350 (= H350), G352 (= G352), E381 (= E381)
- binding magnesium ion: D247 (= D247), E273 (= E273), E300 (= E300)
2hxuA Crystal structure of k220a mutant of l-fuconate dehydratase from xanthomonas campestris liganded with mg++ and l-fuconate (see paper)
57% identity, 99% coverage: 4:423/425 of query aligns to 3:423/434 of 2hxuA
- active site: T54 (= T54), T189 (= T189), K217 (= K217), A219 (≠ K219), D247 (= D247), N249 (= N249), E273 (= E273), G299 (= G299), E300 (= E300), D323 (= D323), P349 (= P349), H350 (= H350), A351 (= A351), D367 (= D367), K374 (≠ S374), E381 (= E381)
- binding 6-deoxy-L-galactonic acid: G21 (= G22), D23 (= D24), Y31 (= Y32), W193 (= W193), K217 (= K217), D247 (= D247), E300 (= E300), H350 (= H350), G352 (= G352), E381 (= E381)
- binding magnesium ion: D247 (= D247), E273 (= E273), E300 (= E300)
4a35A Crystal structure of human mitochondrial enolase superfamily member 1 (enosf1) (see paper)
54% identity, 99% coverage: 3:423/425 of query aligns to 6:429/441 of 4a35A
- active site: K221 (= K217), K223 (= K219), D251 (= D247), N253 (= N249), E277 (= E273), E306 (= E300), D329 (= D323), H356 (= H350), S380 (= S374), E387 (= E381)
- binding magnesium ion: Y188 (= Y184), D251 (= D247), E277 (= E273), E306 (= E300), Y374 (= Y368)
Q7L5Y1 Mitochondrial enolase superfamily member 1; Antisense RNA to thymidylate synthase; rTS; L-fuconate dehydratase; EC 4.2.1.68 from Homo sapiens (Human) (see 5 papers)
54% identity, 99% coverage: 3:423/425 of query aligns to 5:428/443 of Q7L5Y1
- M145 (≠ E142) to T: in dbSNP:rs2612086
- S148 (≠ R145) modified: Phosphoserine
- D250 (= D247) binding
- E276 (= E273) binding
- E305 (= E300) binding
Sites not aligning to the query:
- 1:27 mutation Missing: Impairs protein solubility. Abolishes catalytic activity.
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
26% identity, 99% coverage: 3:421/425 of query aligns to 2:367/372 of 4h19A
- active site: I20 (≠ L20), T51 (= T54), T143 (= T189), K172 (= K217), K174 (= K219), D203 (= D247), N205 (= N249), E229 (= E273), G254 (= G299), E255 (= E300), Q276 (= Q321), D278 (= D323), H305 (= H350), A306 (= A351), G307 (= G352), E327 (= E381)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (= D24), H25 (≠ N27), H52 (≠ I55), K172 (= K217), K174 (= K219), D203 (= D247), N205 (= N249), E229 (= E273), E255 (= E300), H305 (= H350), E327 (= E381)
- binding calcium ion: D268 (≠ M313), H298 (≠ Y343)
- binding magnesium ion: D203 (= D247), E229 (= E273), E255 (= E300)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 46% coverage: 155:350/425 of query aligns to 131:328/398 of Q8ZL58
- K195 (= K217) binding
- K197 (= K219) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D247) binding
- N228 (= N249) binding
- E252 (= E273) binding
- E278 (= E300) binding
- H328 (= H350) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
Sites not aligning to the query:
- 46:48 binding
- 82:83 binding
- 348 binding
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
36% identity, 46% coverage: 155:350/425 of query aligns to 128:325/395 of 2pp1A
- active site: K192 (= K217), K194 (= K219), D223 (= D247), N225 (= N249), E249 (= E273), G274 (= G299), E275 (= E300), D298 (= D323), H325 (= H350)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: F168 (≠ W193), K194 (= K219), E275 (= E300), H325 (= H350)
- binding magnesium ion: D223 (= D247), E249 (= E273), E275 (= E300)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
35% identity, 46% coverage: 155:350/425 of query aligns to 128:325/395 of 2pp3A
- active site: K192 (= K217), A194 (≠ K219), D223 (= D247), N225 (= N249), E249 (= E273), G274 (= G299), E275 (= E300), D298 (= D323), H325 (= H350)
- binding l-glucaric acid: K192 (= K217), D223 (= D247), N225 (= N249), E275 (= E300), H325 (= H350)
- binding magnesium ion: D223 (= D247), E249 (= E273), E275 (= E300)
Sites not aligning to the query:
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
27% identity, 81% coverage: 83:425/425 of query aligns to 78:376/381 of 3ozmD
- active site: S143 (≠ F149), K170 (= K217), K172 (= K219), D200 (= D247), N202 (= N249), E226 (= E273), G252 (= G299), E253 (= E300), N254 (≠ M301), Q274 (= Q321), D276 (= D323), H303 (= H350), T304 (vs. gap), F305 (vs. gap), E328 (≠ D367), I331 (≠ C370), H333 (≠ S372)
- binding L-arabinaric acid: K172 (= K219), D200 (= D247), N202 (= N249), E253 (= E300), H303 (= H350), F305 (vs. gap), E328 (≠ D367)
- binding magnesium ion: D200 (= D247), E226 (= E273), E253 (= E300)
Sites not aligning to the query:
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
27% identity, 81% coverage: 83:425/425 of query aligns to 78:376/386 of 3ozmA
- active site: S143 (≠ F149), K170 (= K217), K172 (= K219), D200 (= D247), N202 (= N249), E226 (= E273), G252 (= G299), E253 (= E300), N254 (≠ M301), Q274 (= Q321), D276 (= D323), H303 (= H350), T304 (vs. gap), F305 (vs. gap), E328 (≠ D367), I331 (≠ C370), H333 (≠ S372)
- binding D-xylaric acid: Y146 (≠ I152), K170 (= K217), K172 (= K219), D200 (= D247), N202 (= N249), E253 (= E300), H303 (= H350), F305 (vs. gap), E328 (≠ D367)
- binding magnesium ion: D200 (= D247), E226 (= E273), E253 (= E300)
Sites not aligning to the query:
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
28% identity, 74% coverage: 111:425/425 of query aligns to 100:371/375 of 3op2A
- active site: S138 (≠ F149), K165 (= K217), K167 (= K219), D195 (= D247), N197 (= N249), E221 (= E273), G247 (= G299), E248 (= E300), N249 (≠ M301), Q269 (= Q321), D271 (= D323), H298 (= H350), T299 (vs. gap), F300 (vs. gap), E323 (≠ D367), I326 (≠ C370), H328 (≠ S372)
- binding 2-oxoglutaric acid: K165 (= K217), K167 (= K219), D195 (= D247), E248 (= E300), H298 (= H350), E323 (≠ D367)
- binding magnesium ion: D195 (= D247), E221 (= E273), E248 (= E300)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
30% identity, 50% coverage: 211:423/425 of query aligns to 158:375/378 of 4hpnA
- active site: K164 (= K217), K166 (= K219), D194 (= D247), N196 (= N249), E220 (= E273), G245 (= G299), E246 (= E300), T247 (≠ M301), Q267 (= Q321), D269 (= D323), H296 (= H350), V297 (≠ A351), W298 (≠ G352), R320 (= R378), E329 (vs. gap), F330 (≠ V383), H334 (= H387)
- binding calcium ion: D194 (= D247), D209 (≠ N262), E220 (= E273), G237 (= G290), E246 (= E300)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
27% identity, 50% coverage: 211:421/425 of query aligns to 142:348/351 of 5olcC
- active site: K148 (= K217), K150 (= K219), D178 (= D247), N180 (= N249), E204 (= E273), G229 (= G299), E230 (= E300), D253 (= D323), H280 (= H350), E304 (≠ S372), E309 (≠ G377)
- binding magnesium ion: D178 (= D247), E204 (= E273), E230 (= E300)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
28% identity, 59% coverage: 171:421/425 of query aligns to 113:366/376 of 3bjsB
- active site: G136 (≠ T189), K164 (= K217), R166 (≠ K219), D194 (= D247), N196 (= N249), E220 (= E273), G246 (= G299), E247 (= E300), N248 (≠ M301), Q268 (= Q321), D270 (= D323), H297 (= H350), S298 (≠ A351), S299 (≠ G352), E322 (= E376), C324 (≠ R378), K327 (≠ E381)
- binding magnesium ion: D194 (= D247), E220 (= E273), E247 (= E300)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
29% identity, 61% coverage: 159:416/425 of query aligns to 101:348/363 of 2og9A
- active site: T132 (= T189), K160 (= K217), K162 (= K219), D191 (= D247), N193 (= N249), E217 (= E273), G242 (= G299), E243 (= E300), M264 (≠ Q321), D266 (= D323), H293 (= H350), F294 (≠ Y359), A295 (≠ V360), E313 (= E381)
- binding calcium ion: A232 (≠ R288), F235 (≠ I291)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
29% identity, 61% coverage: 159:416/425 of query aligns to 112:359/373 of 3cb3A
- active site: T143 (= T189), K171 (= K217), K173 (= K219), D202 (= D247), N204 (= N249), E228 (= E273), G253 (= G299), E254 (= E300), M275 (≠ Q321), D277 (= D323), H304 (= H350), F305 (≠ Y359), A306 (≠ V360), E324 (= E381)
- binding l-glucaric acid: K171 (= K217), K173 (= K219), D202 (= D247), E254 (= E300), H304 (= H350)
- binding magnesium ion: D202 (= D247), E228 (= E273), A243 (≠ R288), F246 (≠ I291), E254 (= E300)
Sites not aligning to the query:
Query Sequence
>HSERO_RS05235 FitnessBrowser__HerbieS:HSERO_RS05235
MTKITALRVLDVRFPTSQSLDGSDAMNPDPDYSAAYVILDTDNAALKGHGLTFTIGRGNE
ICCAAIRAMEHLVVGLELEWIAADMGRFWRHVTSDSQLRWIGPDKGAIHLATGAVVNAAW
DLWAKAEGKPVWKLVADMSPEELVRTIDFRYITDCITPDEALALLREKEAGKAERLRVLE
QEGYPCYTTSAGWLGYEDAKLRRLCQEAIDQGFNHVKLKVGRDLADDKRRVTIAREVLGP
ERKLMIDANQVWEVHQAIDWVNQLAFAQPWFIEEPTSPDDVEGHRKIREGIGAVKVATGE
MCQNRVLFKQFIMRDAIDVVQIDSCRLGGVNEILAVMLMAAKYGKVVCPHAGGVGLCEYV
QHLSMIDYLCISGSKEGRVTEYVDHLHEHFVDPCVVKNAAYMPPSRPGFSIEMKPQSLEQ
YRFRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory