Comparing HSERO_RS05260 FitnessBrowser__HerbieS:HSERO_RS05260 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
36% identity, 91% coverage: 26:310/312 of query aligns to 4:294/295 of 4rxtA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
35% identity, 91% coverage: 29:311/312 of query aligns to 3:290/290 of 4wutA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
30% identity, 88% coverage: 29:301/312 of query aligns to 3:273/274 of 2ioyA
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
30% identity, 77% coverage: 73:311/312 of query aligns to 52:301/303 of 5dkvA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
29% identity, 83% coverage: 29:286/312 of query aligns to 5:269/287 of 5dteB
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 86% coverage: 25:291/312 of query aligns to 4:271/283 of 6gt9A
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
28% identity, 85% coverage: 37:302/312 of query aligns to 19:280/284 of 7e7mC
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
27% identity, 84% coverage: 31:291/312 of query aligns to 6:266/278 of 6guqA
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
25% identity, 84% coverage: 31:292/312 of query aligns to 5:270/276 of 3ksmA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 88% coverage: 27:301/312 of query aligns to 10:284/289 of 5hqjA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
29% identity, 76% coverage: 38:273/312 of query aligns to 12:246/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
28% identity, 76% coverage: 38:273/312 of query aligns to 12:246/305 of 3c6qC
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
28% identity, 82% coverage: 31:286/312 of query aligns to 6:271/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
28% identity, 82% coverage: 31:286/312 of query aligns to 6:271/288 of 8wl9A
5xssA Xylfii molecule (see paper)
29% identity, 82% coverage: 29:283/312 of query aligns to 6:260/274 of 5xssA
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
29% identity, 83% coverage: 31:289/312 of query aligns to 6:270/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
29% identity, 83% coverage: 31:289/312 of query aligns to 6:270/288 of 1gudA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
26% identity, 83% coverage: 29:287/312 of query aligns to 5:262/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
26% identity, 83% coverage: 29:287/312 of query aligns to 5:262/287 of 4ry0A
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
28% identity, 74% coverage: 72:302/312 of query aligns to 45:284/292 of 2fn8A
Sites not aligning to the query:
>HSERO_RS05260 FitnessBrowser__HerbieS:HSERO_RS05260
VFKNKLLGAALGLAFAMGASAAQAQEAYIPLISKGFQHQFWQAVKAGADQAGKDYKVKVT
FEGPETEAMVDKQIDMLSAALAKKPQAIGFAALDSKAAIPLLKKAQAAKIPVVAFDSGVD
SDIPVTTATTDNRAAAALAADKMAELVGKEGEVAVVAHDQTSRTGVDRRDGFLERIKSAY
PKIKVVSVQYGAGDQLKSTEVTKSILQAYPKIKGIFGTNEGSAIGVVNGVKEMKRKIIII
GYDSGKQQKDAIREGIMAGAITQNPVGIGYKTVEAAVKAIKGEKLPKVIDTGFYWYDKSN
IDDAKIAAVLYD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory