SitesBLAST
Comparing HSERO_RS05800 FitnessBrowser__HerbieS:HSERO_RS05800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
74% identity, 96% coverage: 18:455/455 of query aligns to 8:446/446 of P0AES2
- Y150 (= Y160) mutation to F: Reduces activity 100-fold.
- K207 (= K217) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D245) binding
- E266 (= E276) binding
- N289 (= N299) binding
- H339 (= H349) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N351) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D376) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
74% identity, 96% coverage: 18:455/455 of query aligns to 6:444/444 of 1ecqA
- active site: K203 (= K215), K205 (= K217), D233 (= D245), N235 (= N247), E258 (= E270), N287 (= N299), M288 (= M300), D311 (= D323), H337 (= H349), N339 (= N351), I363 (= I375)
- binding 4-deoxyglucarate: N25 (= N37), H30 (= H42), T101 (= T113), Y148 (= Y160), F150 (= F162), K205 (= K217), D233 (= D245), N235 (= N247), N287 (= N299), H337 (= H349), S338 (= S350), N339 (= N351), H366 (= H378), R420 (= R431)
- binding magnesium ion: D233 (= D245), E258 (= E270), N287 (= N299)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
74% identity, 96% coverage: 18:455/455 of query aligns to 6:444/444 of 1ec9D
- active site: K203 (= K215), K205 (= K217), D233 (= D245), N235 (= N247), E258 (= E270), N287 (= N299), M288 (= M300), D311 (= D323), H337 (= H349), N339 (= N351), I363 (= I375)
- binding magnesium ion: D233 (= D245), E258 (= E270), N287 (= N299)
- binding xylarohydroxamate: H30 (= H42), T101 (= T113), Y148 (= Y160), F150 (= F162), K205 (= K217), D233 (= D245), N235 (= N247), N287 (= N299), H337 (= H349), S338 (= S350), N339 (= N351), H366 (= H378), R420 (= R431)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
74% identity, 96% coverage: 18:455/455 of query aligns to 4:442/442 of 1ec8A
- active site: K201 (= K215), K203 (= K217), D231 (= D245), N233 (= N247), E256 (= E270), N285 (= N299), M286 (= M300), D309 (= D323), H335 (= H349), N337 (= N351), I361 (= I375)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N37), H28 (= H42), T99 (= T113), Y146 (= Y160), K203 (= K217), D231 (= D245), N233 (= N247), N285 (= N299), H335 (= H349), S336 (= S350), N337 (= N351), H364 (= H378), R418 (= R431)
- binding magnesium ion: D231 (= D245), E256 (= E270), N285 (= N299)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
74% identity, 96% coverage: 18:455/455 of query aligns to 5:443/443 of 1jctA
- active site: K202 (= K215), K204 (= K217), D232 (= D245), N234 (= N247), E257 (= E270), N286 (= N299), M287 (= M300), D310 (= D323), H336 (= H349), L338 (≠ N351), I362 (= I375)
- binding d-glucarate: N24 (= N37), H29 (= H42), T100 (= T113), Y147 (= Y160), F149 (= F162), K204 (= K217), D232 (= D245), N286 (= N299), S337 (= S350), R419 (= R431)
- binding magnesium ion: D232 (= D245), E257 (= E270), N286 (= N299)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
71% identity, 96% coverage: 18:453/455 of query aligns to 3:428/428 of 3p0wB
- active site: K189 (= K215), K191 (= K217), D219 (= D245), N221 (= N247), E244 (= E270), N273 (= N299), D297 (= D323), H323 (= H349), N325 (= N351)
- binding d-glucarate: H27 (= H42), Y134 (= Y160), K191 (= K217), D219 (= D245), N221 (= N247), N273 (= N299), H323 (= H349), N325 (= N351), H352 (= H378), R406 (= R431)
- binding magnesium ion: D219 (= D245), E244 (= E270), N273 (= N299)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
70% identity, 96% coverage: 16:453/455 of query aligns to 1:424/425 of 3nxlC
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
61% identity, 96% coverage: 18:454/455 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K215), K203 (= K217), D231 (= D245), N233 (= N247), E256 (= E270), N285 (= N299), D309 (= D323), H335 (= H349), N337 (= N351)
- binding magnesium ion: D231 (= D245), N233 (= N247), E256 (= E270), D257 (= D271), N285 (= N299)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
60% identity, 97% coverage: 15:455/455 of query aligns to 1:430/432 of 3n6hB
- active site: K189 (= K215), K191 (= K217), D219 (= D245), N221 (= N247), E244 (= E270), N273 (= N299), D297 (= D323), H323 (= H349), N325 (= N351)
- binding magnesium ion: D219 (= D245), E244 (= E270), N273 (= N299)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
60% identity, 96% coverage: 18:455/455 of query aligns to 3:426/426 of 3pfrA
- active site: K185 (= K215), K187 (= K217), D215 (= D245), N217 (= N247), E240 (= E270), N269 (= N299), D293 (= D323), H319 (= H349), N321 (= N351)
- binding d-glucarate: N22 (= N37), H27 (= H42), Y130 (= Y160), F132 (= F162), K187 (= K217), D215 (= D245), N217 (= N247), N269 (= N299), H319 (= H349), S320 (= S350), N321 (= N351), H348 (= H378)
- binding magnesium ion: D215 (= D245), E240 (= E270), N269 (= N299)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
34% identity, 95% coverage: 20:451/455 of query aligns to 13:425/427 of 3va8A
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
35% identity, 94% coverage: 19:445/455 of query aligns to 5:421/427 of 4it1D
- active site: S51 (≠ V65), D54 (≠ G68), A98 (≠ F114), Y150 (= Y160), K194 (= K215), K196 (= K217), D224 (= D245), N226 (= N247), Y247 (= Y268), E249 (= E270), T271 (= T298), N272 (= N299), M273 (= M300), D296 (= D323), H323 (= H349), S324 (= S350), N325 (= N351), C349 (≠ I375), D350 (= D376)
- binding magnesium ion: D224 (= D245), E249 (= E270), N272 (= N299)
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
35% identity, 94% coverage: 20:445/455 of query aligns to 4:414/420 of 3vc6A
- active site: D52 (≠ G68), H55 (≠ I71), Y146 (= Y160), K188 (= K215), K190 (= K217), D218 (= D245), N220 (= N247), E243 (= E270), N266 (= N299), M267 (= M300), D290 (= D323), H317 (= H349), S318 (= S350), N319 (= N351), H321 (= H353), C343 (≠ I375), D344 (= D376)
- binding magnesium ion: D218 (= D245), E243 (= E270), N266 (= N299)
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
26% identity, 64% coverage: 122:412/455 of query aligns to 98:356/366 of 3dg6A
- active site: M134 (= M157), K160 (= K215), K162 (= K217), D191 (= D245), N193 (= N247), E217 (= E270), D242 (≠ Q295), E243 (≠ T296), S244 (≠ A297), K266 (≠ P320), G292 (= G347), N293 (≠ S348), Q294 (≠ H349), G319 (≠ A374), E320 (≠ I375), L321 (≠ D376)
- binding magnesium ion: D191 (= D245), E217 (= E270), D242 (≠ Q295)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (= M157), K160 (= K215), K162 (= K217), D191 (= D245), N193 (= N247), D242 (≠ Q295), K266 (≠ P320), N293 (≠ S348), Q294 (≠ H349), I295 (≠ S350)
Sites not aligning to the query:
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
24% identity, 88% coverage: 19:418/455 of query aligns to 3:362/373 of 3cb3A
- active site: K24 (≠ L36), S57 (vs. gap), T143 (= T170), K171 (= K215), K173 (= K217), D202 (= D245), N204 (= N247), E228 (= E270), G253 (≠ N299), E254 (≠ M300), M275 (≠ L321), D277 (= D323), H304 (= H349), F305 (≠ V356), A306 (≠ S357), E324 (≠ I375)
- binding l-glucaric acid: K171 (= K215), K173 (= K217), D202 (= D245), E254 (≠ M300), H304 (= H349)
- binding magnesium ion: D202 (= D245), E228 (= E270), A243 (≠ M285), F246 (= F288), E254 (≠ M300)
3t8qB Crystal structure of mandelate racemase/muconate lactonizing enzyme family protein from hoeflea phototrophica
29% identity, 47% coverage: 208:421/455 of query aligns to 140:364/369 of 3t8qB
- active site: K147 (= K215), R149 (≠ K217), D159 (≠ E225), D185 (= D245), N187 (= N247), E211 (= E270), G236 (≠ L294), E237 (≠ Q295), D239 (≠ A297), Q258 (≠ L321), D260 (= D323), H287 (= H349), A288 (≠ S350), A289 (≠ N351), K310 (= K371), E313 (≠ A374)
- binding magnesium ion: D185 (= D245), E211 (= E270), E237 (≠ Q295)
Sites not aligning to the query:
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
24% identity, 82% coverage: 44:418/455 of query aligns to 20:351/363 of 2og9A
- active site: S46 (vs. gap), T132 (= T170), K160 (= K215), K162 (= K217), D191 (= D245), N193 (= N247), E217 (= E270), G242 (≠ N299), E243 (≠ M300), M264 (≠ L321), D266 (= D323), H293 (= H349), F294 (≠ V356), A295 (≠ S357), E313 (≠ I375)
- binding calcium ion: A232 (≠ M285), F235 (= F288)
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
23% identity, 65% coverage: 122:417/455 of query aligns to 87:346/351 of 5olcC
- active site: K148 (= K215), K150 (= K217), D178 (= D245), N180 (= N247), E204 (= E270), G229 (≠ N299), E230 (≠ A302), D253 (≠ H325), H280 (= H340), E304 (≠ A374), E309 (≠ H378)
- binding magnesium ion: D178 (= D245), E204 (= E270), E230 (≠ A302)
4h2hA Crystal structure of an enolase (mandalate racemase subgroup, target efi-502101) from pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine) (see paper)
24% identity, 64% coverage: 121:412/455 of query aligns to 99:357/368 of 4h2hA
- active site: S137 (≠ Y160), Q162 (≠ K215), K164 (= K217), D194 (= D245), E219 (= E270), D242 (vs. gap), E243 (≠ R289), K266 (≠ S313), D293 (≠ G343), D294 (≠ L344), A295 (≠ T345), E318 (≠ A374), G319 (vs. gap), A320 (vs. gap), W321 (vs. gap)
- binding (2S,4R)-4-hydroxy-1,1-dimethylpyrrolidinium-2-carboxylate: Q162 (≠ K215), K164 (= K217), D242 (vs. gap), K266 (≠ S313), A295 (≠ T345), W321 (vs. gap)
- binding magnesium ion: D194 (= D245), E219 (= E270), D242 (vs. gap)
Sites not aligning to the query:
2pmqB Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. Htcc2601 (see paper)
24% identity, 64% coverage: 121:412/455 of query aligns to 97:355/374 of 2pmqB
- active site: S135 (≠ Y160), Q160 (≠ K215), K162 (= K217), D192 (= D245), E217 (= E270), D240 (vs. gap), E241 (≠ R289), K264 (≠ S313), D291 (≠ G343), D292 (≠ L344), A293 (≠ T345), E316 (≠ A374), G317 (vs. gap), A318 (vs. gap), W319 (vs. gap)
- binding magnesium ion: D192 (= D245), E217 (= E270), D240 (vs. gap)
Sites not aligning to the query:
Query Sequence
>HSERO_RS05800 FitnessBrowser__HerbieS:HSERO_RS05800
MSHSAAIPHTVQPVQGAPRVTEMRVIPVAGHDSMLLNLSGAHGPYFTRNLVILTDSAGNT
GVGEVPGGEGIRQTLEDARTLVVGQSIGNVQGILNRARTAFADRDTGGRGLQTFDLRIAI
HAVTALEAALLDLLGKFLDVPVAALLGEGQQRDEVEMLGYLFYVADRNKTDLPYLAAPDA
QDDWTRLRHEAALTPEAVVRLAEAAYARYGFNDFKLKGGVMRGEEEIAAVTALAERFPKA
RITLDPNGGWLLKDAIRLCRDQHDVLAYAEDPCGAEDGYSGREVMAEFRRATGLQTATNM
VATDWRQMGHAISLQSVDIPLADPHFWTMQGSVRVAQMCHEWGLTWGSHSNNHFDVSLAM
FTHVAAAAPGKITAIDTHWIWQDGQRLTREPLQIVGGKVQVPTKPGLGVELDMAQVEAAH
QTYRNMGLGARDDAVAMQYLIPGWKFDPKKPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory