Comparing HSERO_RS06450 FitnessBrowser__HerbieS:HSERO_RS06450 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
28% identity, 99% coverage: 5:305/305 of query aligns to 2:291/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
28% identity, 99% coverage: 5:305/305 of query aligns to 2:291/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
28% identity, 99% coverage: 5:305/305 of query aligns to 2:291/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
28% identity, 99% coverage: 5:305/305 of query aligns to 2:291/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
28% identity, 99% coverage: 5:305/305 of query aligns to 2:291/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
28% identity, 99% coverage: 5:305/305 of query aligns to 2:291/291 of 3pueB
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
32% identity, 99% coverage: 5:305/305 of query aligns to 2:293/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
32% identity, 99% coverage: 5:305/305 of query aligns to 2:293/294 of Q8UGL3
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
27% identity, 92% coverage: 5:286/305 of query aligns to 3:276/295 of 1o5kA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
30% identity, 99% coverage: 5:305/305 of query aligns to 2:291/292 of Q07607
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
27% identity, 92% coverage: 5:286/305 of query aligns to 2:275/294 of Q9X1K9
3lbcD D-sialic acid aldolase complexed with l-arabinose
30% identity, 65% coverage: 1:199/305 of query aligns to 1:192/296 of 3lbcD
Sites not aligning to the query:
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
27% identity, 91% coverage: 9:287/305 of query aligns to 6:275/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
27% identity, 91% coverage: 9:287/305 of query aligns to 6:275/296 of 7lvlA
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
27% identity, 100% coverage: 1:304/305 of query aligns to 2:294/297 of 8u8wA
4pfmA Shewanella benthica dhdps with lysine and pyruvate
27% identity, 93% coverage: 5:288/305 of query aligns to 3:276/295 of 4pfmA
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
30% identity, 64% coverage: 4:199/305 of query aligns to 1:189/292 of 1fdzA
Sites not aligning to the query:
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
30% identity, 64% coverage: 4:199/305 of query aligns to 1:189/292 of 1fdyA
Sites not aligning to the query:
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
29% identity, 65% coverage: 2:199/305 of query aligns to 7:197/302 of 2wpbA
Sites not aligning to the query:
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
30% identity, 65% coverage: 2:199/305 of query aligns to 4:194/299 of 4bwlA
Sites not aligning to the query:
>HSERO_RS06450 FitnessBrowser__HerbieS:HSERO_RS06450
MSIDLRGLVPAPVTPFTRDGAVDHAAIMRLGKWLGSFDGVKGLVVLGHAGEGTFLSQSEQ
AAVIESFVKSTDGRVPVIAGITLEGTQVAAEEAKRAVKAGAAAGLVYPSHGWLRFGYQKG
APQDRYRAIYEESGLPLILFQYPDATKATYNLETQLDIAALPGVFAMKNGVRNMRRWDTE
IPVVRRERPDLQILTCHDEYLLHTMFDVDGALVGYGSIAPELLIDLIAAGKAKDYRKARA
IHDKLLPVTKNVYHRGSHMEGTVALKHALVARGILEHATVRSPLLPLEPGADVEIAKALR
SAEMI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory