Comparing HSERO_RS07420 FitnessBrowser__HerbieS:HSERO_RS07420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw8C Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator (see paper)
65% identity, 96% coverage: 8:158/158 of query aligns to 2:152/152 of 6vw8C
6tg9G Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
50% identity, 87% coverage: 8:145/158 of query aligns to 2:137/148 of 6tg9G
7t2rC Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
40% identity, 91% coverage: 9:152/158 of query aligns to 5:148/152 of 7t2rC
8a5eC Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
32% identity, 94% coverage: 6:153/158 of query aligns to 7:154/156 of 8a5eC
8oh5A Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
32% identity, 93% coverage: 7:153/158 of query aligns to 1:147/150 of 8oh5A
8a6tC Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
29% identity, 88% coverage: 15:153/158 of query aligns to 10:148/151 of 8a6tC
8eswV2 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
31% identity, 82% coverage: 24:153/158 of query aligns to 42:171/214 of 8eswV2
Sites not aligning to the query:
8b9zE Drosophila melanogaster complex i in the active state (dm1) (see paper)
31% identity, 82% coverage: 24:153/158 of query aligns to 42:171/214 of 8b9zE
7awtE E. Coli nadh quinone oxidoreductase hydrophilic arm (see paper)
32% identity, 82% coverage: 25:153/158 of query aligns to 25:153/156 of 7awtE
O52681 Bifurcating [FeFe] hydrogenase gamma subunit; Hydrogenase (NAD(+), ferredoxin) gamma subunit; Iron-hydrogenase gamma subunit; EC 1.12.1.4 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 84% coverage: 26:157/158 of query aligns to 22:153/161 of O52681
7p5hC Tmhydabc- d2 map (see paper)
29% identity, 84% coverage: 26:157/158 of query aligns to 19:150/156 of 7p5hC
8e9gE Mycobacterial respiratory complex i with both quinone positions modelled (see paper)
31% identity, 91% coverage: 15:157/158 of query aligns to 35:177/233 of 8e9gE
5gupE structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
31% identity, 82% coverage: 23:152/158 of query aligns to 54:183/197 of 5gupE
P19404 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NDUFV2; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see 2 papers)
32% identity, 82% coverage: 23:152/158 of query aligns to 76:205/249 of P19404
Sites not aligning to the query:
Q56221 NADH-quinone oxidoreductase subunit 2; NADH dehydrogenase I chain 2; NDH-1 subunit 2; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 2 papers)
33% identity, 72% coverage: 25:138/158 of query aligns to 26:139/181 of Q56221
Sites not aligning to the query:
3i9v2 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
33% identity, 72% coverage: 25:138/158 of query aligns to 24:137/178 of 3i9v2
3iam2 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh (see paper)
33% identity, 72% coverage: 25:138/158 of query aligns to 25:138/179 of 3iam2
7dgq9 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
31% identity, 82% coverage: 23:152/158 of query aligns to 37:166/207 of 7dgq9
Sites not aligning to the query:
P04394 NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; NADH dehydrogenase subunit II; NADH-ubiquinone oxidoreductase 24 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see 2 papers)
31% identity, 82% coverage: 23:152/158 of query aligns to 76:205/249 of P04394
Sites not aligning to the query:
7v2cO Active state complex i from q10 dataset (see paper)
31% identity, 82% coverage: 23:152/158 of query aligns to 44:173/217 of 7v2cO
>HSERO_RS07420 FitnessBrowser__HerbieS:HSERO_RS07420
MKRQQVFDVAAVRGIIAERKEMAGAMLPILHGIQEKVGYIPADAVPMIAGELNVSRAEVH
GVISFYHFFRQEPAGRHVVQVCRAEACQARGGEALAEHAQNVLGCGFHDTSADGQFTLEP
VYCLGQCAIGPNLTLDDELHARVDADKFKRLIQAKREA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory