Comparing HSERO_RS07850 FitnessBrowser__HerbieS:HSERO_RS07850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 100% coverage: 1:335/336 of query aligns to 1:340/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
43% identity, 100% coverage: 1:335/336 of query aligns to 2:341/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
43% identity, 100% coverage: 1:335/336 of query aligns to 2:341/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
43% identity, 100% coverage: 1:335/336 of query aligns to 2:341/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
45% identity, 72% coverage: 1:242/336 of query aligns to 2:236/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
44% identity, 73% coverage: 1:244/336 of query aligns to 3:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
44% identity, 73% coverage: 1:244/336 of query aligns to 3:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
44% identity, 73% coverage: 1:244/336 of query aligns to 3:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
44% identity, 73% coverage: 1:244/336 of query aligns to 3:240/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
46% identity, 67% coverage: 20:244/336 of query aligns to 16:238/240 of 4ymuJ
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 67% coverage: 19:242/336 of query aligns to 40:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 67% coverage: 19:242/336 of query aligns to 40:263/382 of 7aheC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 65% coverage: 1:217/336 of query aligns to 3:218/226 of 5xu1B
7ahdC Opua (e190q) occluded (see paper)
41% identity, 65% coverage: 19:235/336 of query aligns to 40:256/260 of 7ahdC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 67% coverage: 1:226/336 of query aligns to 1:229/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 67% coverage: 1:226/336 of query aligns to 1:229/230 of 1l2tA
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
42% identity, 62% coverage: 1:207/336 of query aligns to 2:203/220 of 8tzjA
7mdyC Lolcde nucleotide-bound
38% identity, 66% coverage: 1:222/336 of query aligns to 2:223/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
38% identity, 66% coverage: 1:222/336 of query aligns to 5:226/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
37% identity, 66% coverage: 1:222/336 of query aligns to 4:225/229 of 7v8iD
>HSERO_RS07850 FitnessBrowser__HerbieS:HSERO_RS07850
VIRIEQLHKTYRAGQRDIIALRDINLDIAQGEVFGIIGRSGAGKSTLIRTLNVLERPDSG
RVLIDGEDITGLGHEALLGLRQRVGMVFQHFNLLNAKTVAQNIDWPLKITGRYSREERAA
RVDELLQLVGLDAHRDQYPSQLSGGQKQRVGIARALANHPRLLLCDEATSALDPETTQSI
LRLLLEINRKLGLTIVLITHEMEVIRSICDRVAVLDGGAVAEQGRVVDIFLRPQHAVTRS
LLTQSHAWDAGESLYQRRPDGKLVRLTYAGDIAAQPILSQLTAATSALATIVRGTVSRIK
DTPYGQLLVEFSGDADALAQVLDRLQTSDIEHEVLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory