SitesBLAST
Comparing HSERO_RS11090 FitnessBrowser__HerbieS:HSERO_RS11090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
61% identity, 98% coverage: 5:398/403 of query aligns to 2:389/392 of P33221
- EL 22:23 (= EL 25:26) binding
- E82 (= E85) binding
- R114 (= R118) binding
- K155 (= K159) binding
- SSGKGQ 160:165 (= SSGKGQ 164:169) binding
- G162 (= G166) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ N183) modified: N6-acetyllysine
- EGVV 195:198 (≠ EGFI 199:202) binding
- E203 (= E207) binding
- E267 (= E276) binding
- E279 (= E288) binding
- D286 (= D295) binding
- K355 (= K364) binding
- RR 362:363 (= RR 371:372) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
61% identity, 98% coverage: 5:398/403 of query aligns to 1:386/389 of 1kjiA
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E264 (= E276), E276 (= E288), D283 (= D295), T284 (= T296), R360 (= R372)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E192 (= E199), V195 (≠ I202), E200 (= E207), Q222 (= Q234), E264 (= E276), F266 (= F278), E276 (= E288)
- binding magnesium ion: E264 (= E276), E276 (= E288)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
61% identity, 98% coverage: 5:398/403 of query aligns to 1:386/389 of 1ez1A
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E264 (= E276), E276 (= E288), D283 (= D295), T284 (= T296), R360 (= R372)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), E192 (= E199), V194 (≠ F201), V195 (≠ I202), F197 (= F204), E200 (= E207), Q222 (= Q234), E264 (= E276), F266 (= F278), E276 (= E288)
- binding glycinamide ribonucleotide: G20 (= G24), E21 (= E25), L22 (= L26), E81 (= E85), I82 (= I86), S160 (= S165), D283 (= D295), K352 (= K364), R359 (= R371), R360 (= R372)
- binding magnesium ion: E264 (= E276), E276 (= E288)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
61% identity, 98% coverage: 5:398/403 of query aligns to 1:386/389 of 1eyzA
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E264 (= E276), E276 (= E288), D283 (= D295), T284 (= T296), R360 (= R372)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E192 (= E199), V195 (≠ I202), F197 (= F204), E200 (= E207), E264 (= E276), F266 (= F278), E276 (= E288)
- binding magnesium ion: E264 (= E276), E276 (= E288)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
61% identity, 98% coverage: 5:398/403 of query aligns to 1:385/388 of 1kjqA
- active site: E114 (= E119), K154 (= K159), E263 (= E276), E275 (= E288), D282 (= D295), T283 (= T296), R359 (= R372)
- binding adenosine-5'-diphosphate: R113 (= R118), I152 (≠ V157), K154 (= K159), E191 (= E199), V193 (≠ F201), V194 (≠ I202), F196 (= F204), E199 (= E207), Q221 (= Q234), F265 (= F278), E275 (= E288)
- binding magnesium ion: E263 (= E276), E275 (= E288)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
61% identity, 98% coverage: 5:398/403 of query aligns to 1:383/386 of 1kjjA
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E261 (= E276), E273 (= E288), D280 (= D295), T281 (= T296), R357 (= R372)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E189 (= E199), V192 (≠ I202), E197 (= E207), Q219 (= Q234), E261 (= E276), F263 (= F278), E273 (= E288)
- binding magnesium ion: E261 (= E276), E273 (= E288)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
61% identity, 98% coverage: 5:398/403 of query aligns to 1:383/386 of 1kj8A
- active site: E114 (= E119), K154 (= K159), S159 (= S164), G161 (= G166), E261 (= E276), E273 (= E288), D280 (= D295), T281 (= T296), R357 (= R372)
- binding adenosine-5'-triphosphate: R113 (= R118), I152 (≠ V157), K154 (= K159), S159 (= S164), S160 (= S165), G161 (= G166), Q164 (= Q169), E189 (= E199), V192 (≠ I202), F194 (= F204), E197 (= E207), Q219 (= Q234), G222 (= G237), E261 (= E276), F263 (= F278), E273 (= E288)
- binding glycinamide ribonucleotide: G20 (= G24), E21 (= E25), L22 (= L26), E81 (= E85), I82 (= I86), S160 (= S165), D280 (= D295), K349 (= K364), R356 (= R371)
- binding magnesium ion: E261 (= E276), E273 (= E288)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
49% identity, 97% coverage: 7:398/403 of query aligns to 8:409/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
47% identity, 97% coverage: 7:398/403 of query aligns to 10:398/409 of 2dwcB
- active site: E265 (= E276), E277 (= E288), D284 (= D295), T285 (= T296), R372 (= R372)
- binding adenosine-5'-diphosphate: R120 (= R118), H159 (≠ V157), K161 (= K159), H190 (≠ F201), I191 (= I202), F193 (= F204), E196 (= E207), F267 (= F278), E277 (= E288)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 91% coverage: 25:391/403 of query aligns to 18:367/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (≠ E119), K147 (= K159), Q158 (= Q169), W184 (≠ F201), V185 (≠ I202), F187 (= F204), E190 (= E207), N216 (≠ G237), F257 (= F278), N267 (≠ S287), E268 (= E288)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E25), L19 (= L26), E76 (= E85), Y153 (vs. gap), R272 (= R292), K340 (= K364), R347 (= R371)
Sites not aligning to the query:
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 91% coverage: 25:391/403 of query aligns to 17:366/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (≠ E119), K146 (= K159), Y152 (vs. gap), G154 (= G166), Q157 (= Q169), W183 (≠ F201), V184 (≠ I202), E189 (= E207), N215 (≠ G237), F256 (= F278), N266 (≠ S287), E267 (= E288)
- binding carbonate ion: R271 (= R292), H273 (= H294), N274 (≠ D295)
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 91% coverage: 25:391/403 of query aligns to 18:367/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G166), E255 (= E276), E268 (= E288), N275 (≠ D295), S276 (≠ T296), K348 (≠ R372)
- binding adenosine-5'-triphosphate: E76 (= E85), F77 (≠ I86), R107 (≠ E119), K147 (= K159), Y153 (vs. gap), D154 (≠ S165), G155 (= G166), Q158 (= Q169), W184 (≠ F201), V185 (≠ I202), F187 (= F204), E190 (= E207), E255 (= E276), F257 (= F278), N267 (≠ S287), E268 (= E288), R272 (= R292), H274 (= H294), N275 (≠ D295), K340 (= K364), R347 (= R371), K348 (≠ R372)
- binding calcium ion: E255 (= E276), E268 (= E288)
- binding phosphate ion: Q47 (= Q54), A49 (= A56)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 91% coverage: 25:391/403 of query aligns to 18:367/377 of 3q2oB
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
28% identity, 91% coverage: 25:391/403 of query aligns to 19:368/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (≠ E119), K148 (= K159), Y154 (vs. gap), D155 (≠ S165), G156 (= G166), Q159 (= Q169), E183 (= E199), W185 (≠ F201), V186 (≠ I202), F188 (= F204), E191 (= E207), H214 (≠ Q234), N217 (≠ G237), E256 (= E276), F258 (= F278), E269 (= E288)
- binding carbonate ion: R273 (= R292), H275 (= H294), N276 (≠ D295)
- binding magnesium ion: T105 (≠ M116), E111 (≠ R122), E256 (= E276), E269 (= E288), L270 (≠ V289)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
27% identity, 91% coverage: 35:400/403 of query aligns to 21:358/360 of 3ax6A
- active site: E231 (= E276), E244 (= E288), N251 (≠ D295), S252 (≠ T296), K330 (≠ R372)
- binding adenosine-5'-diphosphate: K101 (≠ R118), V136 (= V157), K138 (= K159), E164 (= E199), F166 (= F201), V167 (≠ I202), E172 (= E207), F233 (= F278), N243 (≠ S287)
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
29% identity, 75% coverage: 17:319/403 of query aligns to 2:290/373 of 4mamA
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E276), E259 (= E288), N266 (≠ D295), S267 (≠ T296)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R118), I136 (≠ V157), K138 (= K159), Y144 (≠ S164), G146 (= G166), Q149 (= Q169), E175 (= E199), F177 (= F201), V178 (≠ I202), F180 (= F204), E183 (= E207), H206 (≠ Q234), F249 (= F278), E259 (= E288)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
29% identity, 75% coverage: 17:319/403 of query aligns to 2:290/365 of 5jqwA
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E276), E259 (= E288), N266 (≠ D295), S267 (≠ T296)
- binding adenosine-5'-diphosphate: R98 (= R118), K138 (= K159), G143 (≠ S163), Y144 (≠ S164), D145 (≠ S165), G146 (= G166), V178 (≠ I202), E183 (= E207), H206 (≠ Q234), F249 (= F278), E259 (= E288)
Sites not aligning to the query:
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
29% identity, 75% coverage: 17:319/403 of query aligns to 2:290/366 of 4ma0A
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E276), E259 (= E288), N266 (≠ D295), S267 (≠ T296)
- binding adenosine monophosphate: I136 (≠ V157), K138 (= K159), E175 (= E199), A176 (≠ G200), F177 (= F201), V178 (≠ I202), E183 (= E207), H206 (≠ Q234), F249 (= F278), E259 (= E288)
Sites not aligning to the query:
4ma5A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an atp analog, amp-pnp.
29% identity, 75% coverage: 17:319/403 of query aligns to 2:288/363 of 4ma5A
- active site: Y144 (≠ S164), G146 (= G166), E247 (= E276), E257 (= E288), N264 (≠ D295), S265 (≠ T296)
- binding phosphoaminophosphonic acid-adenylate ester: I136 (≠ V157), K138 (= K159), D145 (≠ S165), G146 (= G166), F177 (= F201), V178 (≠ I202), E183 (= E207), H206 (≠ Q234), E247 (= E276), F249 (= F278), N256 (≠ S287), E257 (= E288), H263 (= H294)
Sites not aligning to the query:
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
30% identity, 70% coverage: 81:364/403 of query aligns to 62:322/360 of 3aw8A
- active site: E240 (= E276), E252 (= E288), N259 (≠ D295), S260 (≠ T296)
- binding adenosine monophosphate: L135 (≠ V157), K137 (= K159), Q142 (= Q169), F168 (= F201), V169 (≠ I202), E174 (= E207), H197 (≠ Q234), F242 (= F278), E252 (= E288)
Sites not aligning to the query:
Query Sequence
>HSERO_RS11090 FitnessBrowser__HerbieS:HSERO_RS11090
MKKPTRLGTPLSSSATKVMLLGSGELGKEVIIALQRLGVEVIAVDRYENAPGHQVAHRAH
VINMTDGAALAALIEQEKPDLIVPEIEAIATETLVKLEEAGLARVIPTARAAWLTMNREG
IRRLAGETLGLATSPYRFADSLEELKAAIDQIGYPCVIKPVMSSSGKGQSKIDGPDEIES
AWNYAAAGGRVDAGRVIVEGFIDFDYEITLLTVRSLNENGDTVTSFCDPIGHVQVKGDYV
ESWQPHPMPGAALEKARDIARKVTENLGGLGLFGVELFVKGDMVWFSEVSPRPHDTGMVT
MVSQVQSEFELHAKAILGLPVNTALRTPGASAVIYGQHEARGIAFDGVAEALRIPGAEIR
LFGKPESFARRRMGVALASADNVETARIRAKQAAAKVKPVIPE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory