SitesBLAST
Comparing HSERO_RS12100 FitnessBrowser__HerbieS:HSERO_RS12100 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
37% identity, 99% coverage: 6:341/341 of query aligns to 2:338/340 of 4n54A
- active site: K96 (= K100), H183 (= H185)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R16), K96 (= K100), D156 (= D160), D179 (= D181), M180 (≠ C182), H183 (= H185), R238 (= R241), Y244 (≠ H247)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (= V12), G9 (= G13), L10 (= L14), G11 (= G15), R12 (= R16), L13 (≠ M17), S35 (= S39), V36 (≠ P40), E40 (= E44), S73 (≠ T77), P74 (= P78), F77 (≠ L81), H78 (= H82), E95 (= E99), K96 (= K100), M125 (≠ V129), F167 (= F171), F284 (= F287)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
36% identity, 96% coverage: 7:332/341 of query aligns to 5:331/342 of 3ceaA
- active site: K98 (= K100), H185 (= H185)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), G13 (= G15), R14 (= R16), L15 (≠ M17), L38 (≠ P40), Q42 (≠ E44), V74 (= V76), A75 (≠ T77), P76 (= P78), T77 (= T79), F79 (≠ L81), H80 (= H82), M83 (≠ Q85), E97 (= E99), K98 (= K100), M127 (≠ V129), F169 (= F171), H185 (= H185), F286 (= F287)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
24% identity, 98% coverage: 6:338/341 of query aligns to 2:333/337 of 4l8vA
- active site: K97 (= K100), H176 (= H185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R16), I13 (≠ M17), S74 (≠ T77), W75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ V129), W272 (≠ F287), Y280 (≠ F295)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
28% identity, 89% coverage: 7:311/341 of query aligns to 3:298/339 of 4mjlD
- active site: K97 (= K100)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K100), H155 (≠ A161), N157 (≠ D163), D172 (= D181), T173 (≠ C182), H176 (= H185), Y236 (≠ H247)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (vs. gap), I36 (vs. gap), V73 (= V76), S74 (≠ T77), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ V129), D172 (= D181), W274 (≠ F287), Y282 (≠ F295)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 89% coverage: 7:311/341 of query aligns to 3:298/339 of 4mioD
- active site: K97 (= K100)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K100), H155 (≠ A161), N157 (≠ D163), D172 (= D181), T173 (≠ C182), H176 (= H185), Y236 (≠ H247)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R16), M13 (= M17), D35 (vs. gap), I36 (vs. gap), S74 (≠ T77), A78 (≠ L81), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ V129), D172 (= D181), W274 (≠ F287), Y282 (≠ F295)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 89% coverage: 7:311/341 of query aligns to 3:298/339 of 4mioA
- active site: K97 (= K100)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (vs. gap), I36 (vs. gap), S74 (≠ T77), F75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), W274 (≠ F287), Y282 (≠ F295)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
28% identity, 89% coverage: 7:311/341 of query aligns to 3:298/339 of 4minA
- active site: K97 (= K100)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (vs. gap), I36 (vs. gap), V73 (= V76), S74 (≠ T77), F75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), Y282 (≠ F295)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
24% identity, 98% coverage: 6:338/341 of query aligns to 2:333/337 of 3nt5A
- active site: K97 (= K100), H176 (= H185)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K100), H155 (≠ T158), H176 (= H185), Y235 (≠ H247)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (≠ P40), V36 (≠ L41), S74 (≠ T77), W75 (≠ P78), G76 (≠ T79), E96 (= E99), K97 (= K100), Y280 (≠ F295)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
24% identity, 98% coverage: 6:338/341 of query aligns to 2:333/337 of 3nt4A
- active site: K97 (= K100), H176 (= H185)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ T158), H176 (= H185), Y235 (≠ H247), W272 (≠ F287)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (≠ P40), V36 (≠ L41), S74 (≠ T77), W75 (≠ P78), G76 (≠ T79), E96 (= E99), K97 (= K100), H176 (= H185)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 98% coverage: 6:338/341 of query aligns to 2:333/337 of 3nt2B
- active site: K97 (= K100), H176 (= H185)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), D35 (≠ P40), V36 (≠ L41), S74 (≠ T77), W75 (≠ P78), A78 (≠ L81), K97 (= K100), W272 (≠ F287), Y280 (≠ F295)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 98% coverage: 6:338/341 of query aligns to 2:333/337 of 3nt2A
- active site: K97 (= K100), H176 (= H185)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (≠ P40), V36 (≠ L41), S74 (≠ T77), W75 (≠ P78), G76 (≠ T79), A78 (≠ L81), H79 (= H82), E96 (= E99), K97 (= K100), H176 (= H185), Y280 (≠ F295)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
25% identity, 90% coverage: 6:313/341 of query aligns to 2:297/336 of 3ec7A
- active site: K97 (= K100), H176 (= H185)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), M12 (≠ R16), I13 (≠ M17), D35 (≠ S39), I36 (≠ P40), R40 (≠ E44), T73 (≠ V76), A74 (≠ T77), S75 (≠ P78), N76 (≠ T79), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ V129), W271 (≠ F287), Y279 (≠ F295)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
25% identity, 83% coverage: 58:340/341 of query aligns to 89:372/383 of 1h6dA
- active site: K131 (= K100), Y219 (≠ H185)
- binding glycerol: K131 (= K100), R202 (≠ F168), D215 (= D181), Y219 (≠ H185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y89 (= Y58), I107 (≠ V76), L108 (≠ T77), P109 (= P78), N110 (≠ T79), H113 (= H82), E130 (= E99), K131 (= K100), R159 (≠ V129), A198 (vs. gap), W201 (≠ F167), R202 (≠ F168), Y219 (≠ H185), Y298 (vs. gap)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 17, 18, 19, 40, 41, 42, 43, 44, 66, 67, 71
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
25% identity, 83% coverage: 58:340/341 of query aligns to 87:370/381 of 1rydA
- active site: K129 (= K100), Y217 (≠ H185)
- binding alpha-D-glucopyranose: Y236 (≠ S205), I254 (≠ F229), Q256 (= Q231)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y87 (= Y58), L106 (≠ T77), P107 (= P78), N108 (≠ T79), L110 (= L81), H111 (= H82), E128 (= E99), K129 (= K100), R157 (≠ V129), A196 (vs. gap), W199 (≠ F167), R200 (≠ F168), Y217 (≠ H185), Y296 (vs. gap)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
32% identity, 43% coverage: 58:204/341 of query aligns to 58:206/340 of 1evjA
- active site: K100 (= K100), Y188 (≠ H185)
- binding nicotinamide-adenine-dinucleotide: L77 (≠ T77), P78 (= P78), N79 (≠ T79), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ V129), W170 (≠ F167), R171 (≠ F168), Y188 (≠ H185)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
33% identity, 75% coverage: 7:262/341 of query aligns to 2:251/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R16), F152 (≠ T158), N154 (≠ D160), D175 (= D181), L176 (≠ C182), H179 (= H185), E236 (≠ H247)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (vs. gap), L34 (≠ C38), T70 (≠ V76), T71 (= T77), P72 (= P78), N73 (≠ T79), L75 (= L81), H76 (= H82), Q79 (= Q85), E93 (= E99), K94 (= K100), N122 (≠ G127), W161 (≠ F167), H179 (= H185)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
33% identity, 75% coverage: 7:262/341 of query aligns to 2:251/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R16), N154 (≠ D160), D175 (= D181), H179 (= H185), E236 (≠ H247)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G13), G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (vs. gap), L34 (≠ C38), T70 (≠ V76), T71 (= T77), P72 (= P78), N73 (≠ T79), L75 (= L81), H76 (= H82), Q79 (= Q85), E93 (= E99), K94 (= K100), N122 (≠ G127), W161 (≠ F167)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
33% identity, 75% coverage: 7:262/341 of query aligns to 2:251/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (vs. gap), L34 (≠ C38), T70 (≠ V76), T71 (= T77), P72 (= P78), N73 (≠ T79), L75 (= L81), H76 (= H82), Q79 (= Q85), E93 (= E99), K94 (= K100), N122 (≠ G127), W161 (≠ F167), H179 (= H185)
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
33% identity, 64% coverage: 62:278/341 of query aligns to 55:270/332 of 2glxA
- active site: K93 (= K100), H179 (= H185)
- binding acetate ion: K93 (= K100), H179 (= H185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (≠ V76), T70 (= T77), N72 (≠ T79), H75 (= H82), E92 (= E99), K93 (= K100), H121 (≠ V129), W161 (≠ F167), R162 (≠ F168)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
33% identity, 64% coverage: 62:278/341 of query aligns to 56:271/333 of Q2I8V6
- TTNELH 71:76 (≠ TPTALH 77:82) binding
- EK 93:94 (= EK 99:100) binding
- K94 (= K100) mutation to G: Less than 1% remaining activity.
- N120 (≠ G127) binding
- WR 162:163 (≠ FF 167:168) binding
- D176 (= D181) mutation to A: Less than 1% remaining activity.
- H180 (= H185) mutation to A: Less than 2% remaining activity.
- G206 (≠ A216) mutation to I: No effect.
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
- 283 binding
Query Sequence
>HSERO_RS12100 FitnessBrowser__HerbieS:HSERO_RS12100
MSAPASLQVGLVGLGRMGRRHAENIAFNTPGATLCAVCSPLAQERDWAQQHLPSAERYED
YQALLRHPGLDAVFLVTPTALHGEQIIAALRAGKHVFCEKPLSLDLEECQRVAAEAARHP
QLKVMIGFVRRFDASYQDAHRKISEGLIGAPFMVYSQTADALDPDGFFVRFAASSGGLFL
DCSVHDIDLARWLLGADQPVRVMASGVRAVHHELEAFQDIDNGVAICEFAQGRLATFYAS
RTMAHGHETMTEIVGTRGRLSVGANPSLNRLTIADAHGLRNECTPSFIERFAEAFVAEVR
HFVDAVRYDTPLALTLQDAIEATRIAAAMRQSLLEQQPVQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory