Comparing HSERO_RS12110 FitnessBrowser__HerbieS:HSERO_RS12110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
4ru1A Crystal structure of carbohydrate transporter acei_1806 from acidothermus cellulolyticus 11b, target efi-510965, in complex with myo-inositol
30% identity, 93% coverage: 21:327/331 of query aligns to 9:283/288 of 4ru1A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
24% identity, 89% coverage: 31:325/331 of query aligns to 14:294/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
24% identity, 89% coverage: 31:325/331 of query aligns to 14:294/313 of 2h3hA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
24% identity, 75% coverage: 19:267/331 of query aligns to 9:257/283 of 6gt9A
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
24% identity, 76% coverage: 18:267/331 of query aligns to 3:252/278 of 6guqA
5xssA Xylfii molecule (see paper)
24% identity, 75% coverage: 18:266/331 of query aligns to 5:253/274 of 5xssA
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
26% identity, 57% coverage: 67:255/331 of query aligns to 51:243/288 of 4rxmB
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
26% identity, 57% coverage: 67:255/331 of query aligns to 53:245/291 of 4rxmA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 71% coverage: 31:265/331 of query aligns to 14:247/274 of 2ioyA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
26% identity, 63% coverage: 48:255/331 of query aligns to 35:237/271 of 1dbpA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
20% identity, 73% coverage: 18:259/331 of query aligns to 2:248/290 of 4wutA
3ksmA Crystal structure of abc-type sugar transport system, periplasmic component from hahella chejuensis
19% identity, 72% coverage: 27:263/331 of query aligns to 10:251/276 of 3ksmA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
23% identity, 59% coverage: 66:260/331 of query aligns to 55:260/303 of 5dkvA
Sites not aligning to the query:
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
24% identity, 69% coverage: 31:260/331 of query aligns to 18:254/295 of 4rxtA
Sites not aligning to the query:
>HSERO_RS12110 FitnessBrowser__HerbieS:HSERO_RS12110
MALLAAATPSPSVAANERFVLISHAPDSDSWWNTIKNAIKQAGEDFDVSVDYRNPSNGDL
ADMARLVEQAAARNYNGVVVSIADFSVLKKPIEMVVAKNIPVITINSGTQQQSEQLGALM
HVGQPEYDAGYGAGQKAKAAGIKSFLCVNHYATNPSSFERCRGFAEAIGADYKKSTLDTG
IDPNAVESKVSAYLRNNPGTQAVLALGPDSAVPSLRALQKMGLKSKIWFATFDLSEEIAN
GIKDGSVQFAIDQQPYLQGYIPVAILALSRQLKTNDVAVLQDKLKGNAKFQARLAEYGLA
PIYGPRHISSGPGYITRDNLDKVLKYAGQYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory