Comparing HSERO_RS13235 FitnessBrowser__HerbieS:HSERO_RS13235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
31% identity, 78% coverage: 4:266/336 of query aligns to 8:284/364 of P97084
Sites not aligning to the query:
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
30% identity, 79% coverage: 4:268/336 of query aligns to 2:280/356 of 1lc8A
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
30% identity, 79% coverage: 4:268/336 of query aligns to 5:283/358 of 1lc7A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
30% identity, 79% coverage: 4:268/336 of query aligns to 1:279/355 of 1lkcA
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
24% identity, 77% coverage: 64:322/336 of query aligns to 68:340/354 of 3ly1D
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
27% identity, 78% coverage: 7:269/336 of query aligns to 1:260/335 of 1geyA
Sites not aligning to the query:
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
27% identity, 72% coverage: 29:269/336 of query aligns to 32:274/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
27% identity, 72% coverage: 29:269/336 of query aligns to 32:274/354 of 1fg3A
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
28% identity, 64% coverage: 48:261/336 of query aligns to 56:282/353 of 7szpA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
23% identity, 85% coverage: 28:314/336 of query aligns to 25:319/335 of Q9X0D0
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
23% identity, 85% coverage: 28:314/336 of query aligns to 20:314/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
23% identity, 85% coverage: 28:314/336 of query aligns to 20:314/329 of 1h1cA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
23% identity, 85% coverage: 28:314/336 of query aligns to 19:313/328 of 1uu0A
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
23% identity, 85% coverage: 28:314/336 of query aligns to 26:320/335 of 2f8jA
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
27% identity, 60% coverage: 126:325/336 of query aligns to 141:345/353 of 4r5zA
Sites not aligning to the query:
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
27% identity, 60% coverage: 126:325/336 of query aligns to 141:345/353 of 4r2nA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
27% identity, 58% coverage: 121:315/336 of query aligns to 145:343/360 of 8bj3A
Sites not aligning to the query:
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
27% identity, 55% coverage: 133:316/336 of query aligns to 163:338/369 of 4r8dA
Sites not aligning to the query:
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
28% identity, 34% coverage: 93:207/336 of query aligns to 111:242/387 of 6qp3A
Sites not aligning to the query:
3piuA High-resolution structure of native malus domestica acc synthase (see paper)
22% identity, 59% coverage: 106:303/336 of query aligns to 147:360/409 of 3piuA
Sites not aligning to the query:
>HSERO_RS13235 FitnessBrowser__HerbieS:HSERO_RS13235
MLEHGGNLNDAARHYGRARAQWLDVSTGINPQPYPAPAPLADAWHRLPEPSAALEQAACD
YYGAPRMLAVAGTQAAIQALPQLRLRRDGRPAQVVVAAPIYAEHAHCWRRCGHEVSEVPY
EALDQAVQSPSCQVLVLCNPNNPTGALVEPERLLRWAAQLAERGGWLVVDEAFGDTLTHY
SVAAHTPQTGLIVLRSVGKFFGLAGLRLGFVAAAPALLAELADWLGPWTISGPAQQIGCA
ALRDRDWQAQTRQRLQAQGQRLQQLLARHGIAAQGTALFQWWPEPQAQAFHACMAEAGVW
VRLFTRGAGGIRIGLPPDDAGWQRLHEALTTWSQRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory