Comparing HSERO_RS17000 FitnessBrowser__HerbieS:HSERO_RS17000 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
31% identity, 87% coverage: 43:410/423 of query aligns to 20:391/399 of 5iaiA
Sites not aligning to the query:
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
34% identity, 67% coverage: 44:327/423 of query aligns to 17:306/417 of 4ryaA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
32% identity, 56% coverage: 95:329/423 of query aligns to 72:307/391 of 6dtqA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
28% identity, 68% coverage: 46:333/423 of query aligns to 21:308/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
28% identity, 68% coverage: 46:333/423 of query aligns to 21:308/388 of 3jzjA
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
28% identity, 65% coverage: 48:322/423 of query aligns to 24:309/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
27% identity, 65% coverage: 48:322/423 of query aligns to 65:350/450 of Q7LYW7
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
24% identity, 83% coverage: 48:398/423 of query aligns to 23:372/393 of 5ci5A
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
26% identity, 66% coverage: 11:289/423 of query aligns to 10:291/416 of A9CEY9
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 61% coverage: 31:289/423 of query aligns to 4:261/390 of 7qhvAAA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
25% identity, 61% coverage: 31:289/423 of query aligns to 3:261/384 of 7yzsAAA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
25% identity, 61% coverage: 31:289/423 of query aligns to 5:263/389 of 7ofyA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
26% identity, 61% coverage: 31:289/423 of query aligns to 2:258/382 of 7yzuA
Sites not aligning to the query:
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
28% identity, 42% coverage: 83:261/423 of query aligns to 93:277/471 of G7CES0
Sites not aligning to the query:
8ja7E Cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose
28% identity, 46% coverage: 83:278/423 of query aligns to 65:267/443 of 8ja7E
Sites not aligning to the query:
P9WGU9 Trehalose-binding lipoprotein LpqY; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 46% coverage: 83:278/423 of query aligns to 90:292/468 of P9WGU9
Sites not aligning to the query:
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
28% identity, 42% coverage: 83:261/423 of query aligns to 60:244/435 of 7apeA
Sites not aligning to the query:
8jadA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-17
28% identity, 46% coverage: 83:278/423 of query aligns to 59:261/434 of 8jadA
Sites not aligning to the query:
8jacA Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-16
28% identity, 46% coverage: 83:278/423 of query aligns to 59:261/434 of 8jacA
Sites not aligning to the query:
8ja9A Crystal structure of mycobacterium tuberculosis lpqy in complex with trehalose analogue yb-03
28% identity, 46% coverage: 83:278/423 of query aligns to 59:261/434 of 8ja9A
Sites not aligning to the query:
>HSERO_RS17000 FitnessBrowser__HerbieS:HSERO_RS17000
VNKICLGAACAVLGAALPLVASAQSCNVPVLKVLAQKSLGLTVMEKSLADYQKRSGTRIE
ISYFGENDRRAKSRLDAATKAGSYQVYYVDEANVAEFASAGWIVPLLKYFPKDADYDDFL
PGRRAVASYKDVAYFAPLIGGSDFLFYRRDLLEKAGLPVPRTLDELVADIKKLHSPPSVY
GWVARGQRGSGMNVWRWAPFMLAQGGQWTDKNNQPAFNSPAAVKATQLYADLFKYAPPGA
ATYDWSNALEAFRSGKVAFMIESTPFADWMEDSSKSSVADKVGYARPPAPLPSAAYGHGL
AISAVGAKDECTRQAAGKFIAFATGKEQEQARLREKVFSDYNRSSTIQSDYFQKNVKPQI
LAGLKDTTPVSKLTIWPSPQWPDIGDNLGVALEEVFTGTQKDITRALDEAAQYAQDAMEH
ARK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory