SitesBLAST
Comparing HSERO_RS17460 FitnessBrowser__HerbieS:HSERO_RS17460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
52% identity, 99% coverage: 4:249/249 of query aligns to 3:249/249 of 4bmsF
- active site: S137 (= S140), H147 (≠ Q150), Y150 (= Y153), K154 (= K157), Q195 (≠ R198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ S16), S16 (≠ E17), I18 (= I19), R38 (= R39), R39 (= R40), A59 (≠ G60), D60 (= D61), V61 (≠ A62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (≠ L113), S137 (= S140), Y150 (= Y153), K154 (= K157), G181 (= G184), I183 (≠ T186), T185 (= T188), I187 (≠ L190)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
52% identity, 99% coverage: 4:249/249 of query aligns to 3:249/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S140), H147 (≠ Q150), Y150 (= Y153), L188 (≠ M191), L246 (≠ S246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), N15 (≠ S16), S16 (≠ E17), G17 (= G18), I18 (= I19), R38 (= R39), R39 (= R40), D60 (= D61), V61 (≠ A62), N87 (= N88), S88 (≠ A89), G89 (= G90), V110 (≠ L113), T135 (≠ N138), S137 (= S140), Y150 (= Y153), K154 (= K157), P180 (= P183), G181 (= G184), A182 (≠ G185), I183 (≠ T186), T185 (= T188), S187 (≠ L190)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
41% identity, 99% coverage: 4:249/249 of query aligns to 3:241/241 of 5t2uA
- active site: G17 (= G18), T135 (≠ S140), T145 (≠ Q150), Y148 (= Y153), K152 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), G17 (= G18), R38 (= R39), D39 (≠ R40), R42 (≠ K43), D60 (= D61), L61 (≠ A62), N83 (= N88), A84 (= A89), Y87 (≠ K97), I133 (≠ N138), T135 (≠ S140), Y148 (= Y153), K152 (= K157), P178 (= P183), P180 (≠ G185), T181 (= T186), T183 (= T188), T185 (≠ L190), T186 (≠ M191)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 97% coverage: 4:245/249 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N114), S139 (= S140), Q149 (= Q150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ A96), K98 (≠ M101), S139 (= S140), N146 (≠ F147), V147 (≠ P148), Q149 (= Q150), Y152 (= Y153), F184 (≠ G185), M189 (≠ L190), K200 (≠ V204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ E17), G18 (= G18), I19 (= I19), D38 (≠ G38), F39 (≠ R39), V59 (≠ G60), D60 (= D61), V61 (≠ A62), N87 (= N88), A88 (= A89), G89 (= G90), I90 (≠ T91), T137 (≠ N138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ G185), T185 (= T186), T187 (= T188), M189 (≠ L190)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
39% identity, 97% coverage: 5:245/249 of query aligns to 3:243/251 of 4esoB
- active site: G16 (= G18), S136 (= S140), M146 (≠ Q150), Y149 (= Y153), K153 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), T14 (≠ S16), H15 (≠ E17), M17 (≠ I19), R37 (= R39), N38 (≠ R40), N41 (≠ K43), S58 (≠ G60), D59 (= D61), I60 (≠ A62), N86 (= N88), A87 (= A89), G88 (= G90), T134 (≠ N138), S136 (= S140), Y149 (= Y153), P179 (= P183), G180 (= G184), I182 (vs. gap), T184 (= T186), T186 (= T188), K187 (≠ R189), G188 (≠ L190)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
36% identity, 98% coverage: 4:246/249 of query aligns to 5:258/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S140), N144 (≠ V141), T145 (≠ A142), F153 (≠ Q150), Y156 (= Y153), G187 (= G184), M193 (≠ L190), V197 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ E17), I20 (= I19), A40 (vs. gap), N41 (vs. gap), S42 (= S37), D66 (= D61), N93 (= N88), S94 (≠ A89), L116 (= L113), T141 (≠ N138), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (= G184), G188 (= G185), T189 (= T186), T191 (= T188), M193 (≠ L190)
Sites not aligning to the query:
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
36% identity, 100% coverage: 1:248/249 of query aligns to 2:252/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S140), I145 (≠ V141), E146 (≠ A142), Y157 (= Y153), V197 (≠ M191), F207 (≠ L205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), T17 (≠ S16), I20 (= I19), R40 (= R39), H41 (≠ R40), D64 (= D61), A65 (= A62), N91 (= N88), A92 (= A89), V114 (≠ L113), M142 (≠ N138), S144 (= S140), Y157 (= Y153), K161 (= K157), P189 (= P183), G190 (= G184), P191 (≠ G185), I192 (≠ T186), T194 (= T188), P195 (≠ R189), L196 (= L190)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
35% identity, 98% coverage: 4:246/249 of query aligns to 9:263/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S140), Y161 (= Y153), G193 (= G185), M198 (≠ L190), F199 (≠ M191), V202 (vs. gap), S203 (vs. gap), Y206 (= Y194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G14), R22 (≠ E17), G23 (= G18), I24 (= I19), Y43 (vs. gap), A44 (vs. gap), N45 (vs. gap), S46 (= S37), D70 (= D61), V71 (≠ A62), N97 (= N88), S98 (≠ A89), L120 (= L113), T145 (≠ N138), S147 (= S140), Y161 (= Y153), K165 (= K157), P191 (= P183), G192 (= G184), T194 (= T186), T196 (= T188), M198 (≠ L190)
4cqmF Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
37% identity, 96% coverage: 7:245/249 of query aligns to 6:236/241 of 4cqmF
- active site: G17 (= G18), S139 (= S140), Q149 (= Q150), Y152 (= Y153), K156 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ E17), G17 (= G18), I18 (= I19), A37 (≠ G38), R38 (= R39), N39 (≠ R40), D60 (= D61), V61 (≠ A62), A87 (≠ N88), A88 (= A89), G89 (= G90), V137 (≠ N138), S139 (= S140), Y152 (= Y153), K156 (= K157), V185 (≠ T186), T187 (= T188), M189 (≠ L190)
Q8N4T8 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; KAR beta subunit; Carbonyl reductase family member 4; CBR4; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; EC 1.1.1.100; EC 1.6.5.10 from Homo sapiens (Human) (see 4 papers)
37% identity, 96% coverage: 7:245/249 of query aligns to 2:232/237 of Q8N4T8
- G9 (= G14) mutation to S: Unable to restore growth of an OAR1-deficient yeast mutant.
- SRGI 11:14 (≠ SEGI 16:19) binding
- R12 (≠ E17) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant.
- R34 (= R39) mutation to A: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Strongly reduces NADPH-dependent reductase activity with acetoacetyl-CoA and 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- RN 34:35 (≠ RR 39:40) binding
- D56 (= D61) binding
- L70 (≠ V75) to M: in dbSNP:rs2877380
- AAG 83:85 (≠ NAG 88:90) binding
- S135 (= S140) mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- Y148 (= Y153) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant.
- K152 (= K157) binding ; mutation to A: Unable to restore growth of an OAR1-deficient yeast mutant. Abolishes NADPH-dependent reductase activity with acetoacetyl-CoA. Strongly reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- R168 (≠ E173) mutation to E: Strongly reduced ability to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- K169 (≠ R174) mutation to E: Unable to restore growth of an OAR1-deficient yeast mutant. Increases NADPH-dependent reductase activity with acetoacetyl-CoA. Reduces NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on NADH-dependent reductase activities.
- VHT 181:183 (≠ TET 186:188) binding
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
37% identity, 98% coverage: 5:247/249 of query aligns to 8:252/262 of 3pk0B
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
36% identity, 98% coverage: 4:248/249 of query aligns to 3:250/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S140), I143 (≠ V141), Y155 (= Y153), F205 (≠ L205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (≠ S16), L16 (≠ E17), G17 (= G18), I18 (= I19), R38 (= R39), H39 (≠ R40), D62 (= D61), A63 (= A62), N89 (= N88), A90 (= A89), V112 (≠ L113), M140 (≠ N138), S142 (= S140), Y155 (= Y153), K159 (= K157), P187 (= P183), P189 (≠ G185), I190 (≠ T186), T192 (= T188), P193 (≠ R189), L194 (= L190)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
35% identity, 98% coverage: 4:246/249 of query aligns to 5:259/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ V141), T145 (≠ A142), F154 (≠ Q150), G189 (= G185), V198 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), R18 (≠ E17), I20 (= I19), Y39 (vs. gap), A40 (vs. gap), N41 (vs. gap), S42 (= S37), D66 (= D61), V67 (≠ A62), N93 (= N88), S94 (≠ A89), L116 (= L113), T141 (≠ N138), Y157 (= Y153), K161 (= K157), P187 (= P183), T190 (= T186), T192 (= T188), M194 (≠ L190)
Sites not aligning to the query:
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
37% identity, 100% coverage: 1:248/249 of query aligns to 1:251/252 of Q6WVP7
Sites not aligning to the query:
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
34% identity, 99% coverage: 1:247/249 of query aligns to 3:250/259 of 6ci9D
- active site: G20 (= G18), S145 (= S140), Y159 (= Y153)
- binding 1-aminopropan-2-one: F97 (≠ A92), S145 (= S140), T147 (≠ A142), W156 (≠ Q150), Y159 (= Y153), G190 (= G184)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G14), S18 (= S16), G20 (= G18), I21 (= I19), G40 (= G38), R41 (= R39), N42 (≠ R40), D66 (= D61), V67 (≠ A62), N93 (= N88), G95 (= G90), T143 (≠ N138), S145 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), N191 (≠ G185), I192 (≠ T186), T194 (= T188), G196 (vs. gap), L197 (vs. gap)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 98% coverage: 3:245/249 of query aligns to 7:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), S20 (= S16), K21 (≠ E17), G22 (= G18), I23 (= I19), A43 (≠ V36), S44 (= S37), S45 (≠ G38), G68 (= G60), D69 (= D61), V70 (≠ A62), N96 (= N88), S97 (≠ A89), G98 (= G90), Y100 (≠ T94), I144 (≠ N138), S146 (= S140), Y159 (= Y153), K163 (= K157), P189 (= P183), G190 (= G184), M191 (vs. gap), I192 (vs. gap), T194 (vs. gap), G196 (= G185), T197 (= T186)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S140), Y159 (= Y153), M191 (vs. gap), I202 (≠ L190)
1zk4A Structure of r-specific alcohol dehydrogenase (wildtype) from lactobacillus brevis in complex with acetophenone and NADP (see paper)
34% identity, 99% coverage: 2:248/249 of query aligns to 1:250/251 of 1zk4A
- active site: G17 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding 1-phenylethanone: A93 (= A92), Y155 (= Y153), Y189 (≠ G185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), T15 (≠ S16), L16 (≠ E17), I18 (= I19), T36 (≠ S37), G37 (= G38), R38 (= R39), H61 (≠ G60), D62 (= D61), N89 (= N88), A90 (= A89), G91 (= G90), I92 (≠ T91), Y155 (= Y153), G188 (= G184), I190 (≠ T186), T192 (= T188), L194 (= L190)
6y0sAAA R-specific alcohol dehydrogenase (see paper)
34% identity, 99% coverage: 2:248/249 of query aligns to 1:250/251 of 6y0sAAA
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 98% coverage: 5:249/249 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G18), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ E17), G16 (= G18), I17 (= I19), D36 (≠ G38), I37 (≠ R39), A61 (≠ G60), D62 (= D61), T63 (≠ A62), N89 (= N88), A90 (= A89), M140 (≠ N138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), A186 (≠ G184), Y187 (≠ G185), I188 (≠ T186), L192 (= L190)
Q12634 Tetrahydroxynaphthalene reductase; T4HN reductase; THNR; EC 1.1.1.252 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see 2 papers)
32% identity, 98% coverage: 5:247/249 of query aligns to 27:282/283 of Q12634
- 39:63 (vs. 17:37, 32% identical) binding
- Y178 (= Y153) active site, Proton acceptor
Query Sequence
>HSERO_RS17460 FitnessBrowser__HerbieS:HSERO_RS17460
MAKRFEDKVVVVTGGSEGIGLATAKLFAAEGARVYVSGRRADKLEQAVREIGNGAVGVPG
DAAKLDDLDRLYARVQADHGRLDVLFANAGTASTEAKPLGMIGEEDFDGLFNLNVRGLLF
SVQKALPLMSQGGAIVLNGSVAGVKGFPGQSLYNASKAAVRSFARSWTADLKERGIRVNV
VAPGGTETRLMRDYLEARPGMEDVLKQVVPLGRLGEPDEIGRAVLFLASAESSYIAGVEL
FVDGGSVAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory