SitesBLAST
Comparing HSERO_RS18285 FitnessBrowser__HerbieS:HSERO_RS18285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7q06D Crystal structure of tpado in complex with 2-oh-tpa (see paper)
42% identity, 95% coverage: 15:419/426 of query aligns to 3:386/389 of 7q06D
- binding 2-Hydroxyterephthalic acid: V203 (= V215), S206 (≠ P218), A209 (= A221), F216 (≠ H228), N222 (≠ F234), S241 (= S274), I268 (= I301), R287 (= R320)
- binding fe (iii) ion: H208 (= H220), H213 (= H225), D334 (= D367)
- binding fe2/s2 (inorganic) cluster: C80 (= C92), H82 (= H94), R83 (= R95), C100 (= C112), Y102 (= Y114), H103 (= H115), W105 (= W117)
7q05E Crystal structure of tpado in complex with tpa (see paper)
42% identity, 95% coverage: 15:419/426 of query aligns to 3:391/409 of 7q05E
- binding fe2/s2 (inorganic) cluster: C80 (= C92), H82 (= H94), R83 (= R95), C100 (= C112), Y102 (= Y114), H103 (= H115), W105 (= W117)
- binding terephthalic acid: V203 (= V215), A209 (= A221), S241 (≠ L250), L271 (≠ N299), I273 (= I301), R292 (= R320), D339 (= D367)
7vjuA Crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 (see paper)
42% identity, 95% coverage: 15:419/426 of query aligns to 2:375/378 of 7vjuA
7q04D Crystal structure of tpado in a substrate-free state (see paper)
41% identity, 95% coverage: 15:419/426 of query aligns to 2:372/374 of 7q04D
7c8zA Crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) (see paper)
35% identity, 95% coverage: 17:419/426 of query aligns to 8:382/383 of 7c8zA
- active site: H106 (= H115), D213 (= D217), H216 (= H220), H221 (= H225), D330 (= D367)
- binding fe (iii) ion: H216 (= H220), H221 (= H225), D330 (= D367)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), C103 (= C112), H106 (= H115), W108 (= W117)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
27% identity, 92% coverage: 29:422/426 of query aligns to 21:430/436 of 1wqlA
- active site: H106 (= H115), D208 (= D217), H211 (= H220), H217 (= H225), D365 (= D367)
- binding fe (ii) ion: H211 (= H220), H217 (= H225), D365 (= D367)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), R86 (= R95), C103 (= C112), Y105 (= Y114), H106 (= H115), W108 (= W117)
- binding oxygen molecule: H211 (= H220), F355 (≠ V357)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
28% identity, 92% coverage: 29:421/426 of query aligns to 20:414/425 of 1uliC
- active site: H105 (= H115), D205 (= D217), H208 (= H220), H214 (≠ L226), D350 (= D367)
- binding fe (ii) ion: H208 (= H220), H214 (≠ L226), D350 (= D367)
- binding fe2/s2 (inorganic) cluster: C82 (= C92), H84 (= H94), R85 (= R95), C102 (= C112), Y104 (= Y114), H105 (= H115), W107 (= W117)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
26% identity, 92% coverage: 29:421/426 of query aligns to 36:442/460 of Q53122
- C98 (= C92) binding
- H100 (= H94) binding
- C118 (= C112) binding
- H121 (= H115) binding
- 217:230 (vs. 214:226, 29% identical) binding
- H224 (= H220) binding
- H230 (≠ L226) binding
- D378 (= D367) binding
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
34% identity, 46% coverage: 29:222/426 of query aligns to 21:208/432 of 2xrxA
- active site: H106 (= H115), D203 (= D217), H206 (= H220)
- binding biphenyl: Q199 (≠ N214), F200 (vs. gap), D203 (= D217), H206 (= H220)
- binding fe (ii) ion: Q199 (≠ N214), H206 (= H220)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), R86 (= R95), C103 (= C112), Y105 (= Y114), H106 (= H115), W108 (= W117)
Sites not aligning to the query:
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
28% identity, 92% coverage: 29:421/426 of query aligns to 20:416/425 of 1uljA
- active site: H105 (= H115), D205 (= D217), H208 (= H220), H214 (= H225), D352 (= D367)
- binding biphenyl: Q201 (≠ N214), F202 (vs. gap), D205 (= D217), M206 (≠ P218), H208 (= H220), A209 (= A221), H214 (= H225), I252 (≠ A264), H287 (= H300), L297 (≠ Q311), F342 (≠ V357)
- binding fe (ii) ion: Q201 (≠ N214), H208 (= H220), H214 (= H225), D352 (= D367)
- binding fe2/s2 (inorganic) cluster: C82 (= C92), H84 (= H94), R85 (= R95), M87 (≠ A97), C102 (= C112), Y104 (= Y114), H105 (= H115), W107 (= W117)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
34% identity, 46% coverage: 29:222/426 of query aligns to 21:209/433 of 5aeuA
Sites not aligning to the query:
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
34% identity, 46% coverage: 29:222/426 of query aligns to 21:209/433 of 2yflA
- active site: H106 (= H115), D204 (= D217), H207 (= H220)
- binding 2-chlorodibenzofuran: Q200 (≠ N214), D204 (= D217), M205 (≠ P218), H207 (= H220)
- binding fe (ii) ion: Q200 (≠ N214), H207 (= H220)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), R86 (= R95), C103 (= C112), Y105 (= Y114), H106 (= H115), W108 (= W117)
Sites not aligning to the query:
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
34% identity, 46% coverage: 29:222/426 of query aligns to 21:209/433 of 2yfjA
- active site: H106 (= H115), D204 (= D217), H207 (= H220)
- binding dibenzofuran: Q200 (≠ N214), F201 (vs. gap), D204 (= D217), M205 (≠ P218), H207 (= H220), A208 (= A221)
- binding fe (ii) ion: Q200 (≠ N214), H207 (= H220)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), R86 (= R95), C103 (= C112), Y105 (= Y114), H106 (= H115), W108 (= W117)
Sites not aligning to the query:
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
34% identity, 46% coverage: 29:222/426 of query aligns to 21:209/433 of 2xshA
- active site: H106 (= H115), D204 (= D217), H207 (= H220)
- binding 2,6-dichlorobiphenyl: F201 (vs. gap), M205 (≠ P218), H207 (= H220)
- binding fe (ii) ion: Q200 (≠ N214), H207 (= H220)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), R86 (= R95), C103 (= C112), Y105 (= Y114), H106 (= H115), W108 (= W117)
Sites not aligning to the query:
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
26% identity, 94% coverage: 22:422/426 of query aligns to 14:434/440 of 3gzxA
- active site: H106 (= H115), D213 (= D217), H216 (= H220), H222 (= H225), D369 (= D367)
- binding biphenyl: Q209 (≠ N214), F210 (vs. gap), H216 (= H220), G302 (vs. gap), H304 (vs. gap), L314 (≠ Q311)
- binding fe (ii) ion: Q209 (≠ N214), H216 (= H220), H222 (= H225), D369 (= D367)
- binding fe2/s2 (inorganic) cluster: C83 (= C92), H85 (= H94), R86 (= R95), C103 (= C112), Y105 (= Y114), H106 (= H115), W108 (= W117)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
34% identity, 47% coverage: 23:221/426 of query aligns to 14:209/424 of 3en1A
- active site: H105 (= H115), D205 (= D217), H208 (= H220)
- binding fe (ii) ion: Q201 (≠ N214), H208 (= H220)
- binding fe2/s2 (inorganic) cluster: C82 (= C92), H84 (= H94), R85 (= R95), C102 (= C112), Y104 (= Y114), H105 (= H115), W107 (= W117)
- binding toluene: Q201 (≠ N214), F202 (vs. gap), D205 (= D217), H208 (= H220)
Sites not aligning to the query:
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
34% identity, 49% coverage: 16:225/426 of query aligns to 17:225/471 of O85673
- M43 (≠ Q41) mutation to K: Prevents anthranilate degradation.
- D217 (= D217) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
34% identity, 47% coverage: 26:225/426 of query aligns to 23:221/441 of 2b1xA
- active site: H111 (= H115), D213 (= D217), H216 (= H220), H221 (= H225)
- binding fe (iii) ion: H216 (= H220), H221 (= H225)
- binding fe2/s2 (inorganic) cluster: C88 (= C92), H90 (= H94), R91 (= R95), C108 (= C112), Y110 (= Y114), H111 (= H115), W113 (= W117)
Sites not aligning to the query:
2b24A Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. Bound to indole (see paper)
34% identity, 47% coverage: 26:225/426 of query aligns to 23:221/440 of 2b24A
- active site: H111 (= H115), D213 (= D217), H216 (= H220), H221 (= H225)
- binding fe (iii) ion: H216 (= H220), H221 (= H225)
- binding fe2/s2 (inorganic) cluster: C88 (= C92), H90 (= H94), R91 (= R95), C108 (= C112), Y110 (= Y114), H111 (= H115), W113 (= W117)
- binding indole: D213 (= D217)
Sites not aligning to the query:
2ckfE Crystal structure of the terminal component of the pah- hydroxylating dioxygenase from sphingomonas sp chy-1 (see paper)
26% identity, 92% coverage: 29:421/426 of query aligns to 18:404/433 of 2ckfE
- active site: H103 (= H115), D204 (= D217), H207 (= H220), H212 (= H225), D340 (= D367)
- binding fe (iii) ion: H207 (= H220), H212 (= H225), D340 (= D367)
- binding fe2/s2 (inorganic) cluster: C80 (= C92), H82 (= H94), R83 (= R95), C100 (= C112), Y102 (= Y114), H103 (= H115), W105 (= W117)
Query Sequence
>HSERO_RS18285 FitnessBrowser__HerbieS:HSERO_RS18285
MNTSTPLEQQGYAPLVQFPRTDGARTPYKVFSSREVYDLEQERIYRGETWSFLALEAEIP
NNGDYKSTFVGDTPVVVTRTEDGALAAWVNKCSHRGAMVCRTPRGNASSHSCAYHQWSFD
SRGNLLGVPFRRGQKGATGMAKDFDPKCHGLRQLRVDSYKGLVFATFSETVEALPDYIGA
EMRPWIDRIFHKPIVYLGCTRQYSKSNWKLYLENVKDPYHASLLHLFHTTFNIFRVGMKA
RSLADKHHGLHSIITATKNEVETADAYKQQEIRSFDEGFSLQDPSVLGQIKEFEELTTNH
IQPIFPQLVVQQIHNTLVARQLLPKGPSNFELVFHFFGYEDDTPELRALRIKQANLVGPA
GYISMEDTEATELVQRGTARDPDQCSVIDMARDNPDQEDTLITESLIRKFWMGYQKLMGF
PSIEKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory