Comparing HSERO_RS18800 FitnessBrowser__HerbieS:HSERO_RS18800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7x8eA Crystal structure of pfhppd-y13287 complex
34% identity, 88% coverage: 13:269/293 of query aligns to 5:261/341 of 7x8eA
Sites not aligning to the query:
7xntA Crystal structure of pfhppd-y13161 complex
34% identity, 88% coverage: 13:269/293 of query aligns to 6:268/341 of 7xntA
Sites not aligning to the query:
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
39% identity, 65% coverage: 13:201/293 of query aligns to 3:189/352 of 1cjxA
Sites not aligning to the query:
7xntC Crystal structure of pfhppd-y13161 complex
39% identity, 61% coverage: 13:190/293 of query aligns to 5:183/320 of 7xntC
Sites not aligning to the query:
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
31% identity, 71% coverage: 6:212/293 of query aligns to 277:487/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
31% identity, 71% coverage: 6:212/293 of query aligns to 275:490/635 of Q88JU3
Sites not aligning to the query:
>HSERO_RS18800 FitnessBrowser__HerbieS:HSERO_RS18800
MMNTIENNPVPTNPLGIDGIEFIEYATTEPLALGAVLERMGFEQVGRHRSREVVLYTQGE
MNVIVNADATAWAGFDHEVQATSLSAIALRVRDANEAYRRVTELGAWAIPTRAGAMELNI
PGVHGCGDSIIYFVDRYRDFSIYDVDFKPASQERRQTSALAGLHFFGLVQAVQPDRLREW
IDFYSTLMGFSVLPEGQFFGILPKGSLLVSPCRQFYIQLVEPPAGTEDIHWEEELLRLGL
GTPDVLQAVRQLQERGVVFVDRAPTQISERGALTQLYKGGVSFELVRSQKEKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory