Comparing HSERO_RS19255 FitnessBrowser__HerbieS:HSERO_RS19255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
43% identity, 84% coverage: 29:294/315 of query aligns to 8:273/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
43% identity, 84% coverage: 29:294/315 of query aligns to 9:274/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
43% identity, 77% coverage: 29:270/315 of query aligns to 6:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 78% coverage: 29:273/315 of query aligns to 6:241/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 73% coverage: 36:266/315 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 73% coverage: 36:266/315 of query aligns to 4:223/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
29% identity, 76% coverage: 29:266/315 of query aligns to 3:227/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
32% identity, 76% coverage: 29:267/315 of query aligns to 3:229/229 of 5t0wA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
24% identity, 77% coverage: 31:273/315 of query aligns to 8:246/246 of 4ohnA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
29% identity, 70% coverage: 29:249/315 of query aligns to 7:217/251 of 1xt8B
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
26% identity, 69% coverage: 29:245/315 of query aligns to 8:224/324 of 4z9nB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
27% identity, 70% coverage: 27:247/315 of query aligns to 1:213/231 of 2v25A
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
28% identity, 73% coverage: 36:266/315 of query aligns to 4:226/234 of 3k4uE
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
24% identity, 79% coverage: 24:273/315 of query aligns to 4:241/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
24% identity, 79% coverage: 24:273/315 of query aligns to 4:241/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
24% identity, 79% coverage: 24:273/315 of query aligns to 4:241/241 of 3vvdA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
27% identity, 70% coverage: 47:266/315 of query aligns to 14:221/226 of 8eyzA
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
23% identity, 78% coverage: 29:273/315 of query aligns to 6:237/237 of 3vv5A
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
25% identity, 73% coverage: 37:266/315 of query aligns to 5:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
25% identity, 73% coverage: 37:266/315 of query aligns to 5:231/238 of 1lahE
>HSERO_RS19255 FitnessBrowser__HerbieS:HSERO_RS19255
MKLLKLAGVLVGASVLMSSVHAEEFTGRLKKIKDSGTLTLGVRDSSIPFSYLDDKQSYQG
YSIDLCLKAATAIQKKLGLTSLNIKMVPVTSATRIPLIANGTTDISCDSATNNQERWNQV
AFSVTEFVTANKFLSKKAANLKTLEDLKGKTVVSTSGTSNLKQITALNAERNLGMNILAA
KDHAEAFLMVETGRAAAFVMDDILLSSLAANSKAPGDYQVSSEALSVEPYGLILPKGDKE
FKTVVDDALTVVYKGDDIKKIYAKWFQSPIPPKGVNLNVPMSPQLQAVLAKPTDSYDPAA
YAVVPEAQKNMGKKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory