Comparing HSERO_RS20090 FitnessBrowser__HerbieS:HSERO_RS20090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
39% identity, 92% coverage: 23:303/305 of query aligns to 17:289/290 of 3e5zA
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
40% identity, 90% coverage: 23:297/305 of query aligns to 32:298/299 of 3dr2A
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
26% identity, 87% coverage: 25:289/305 of query aligns to 1:271/293 of 7risA
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
27% identity, 88% coverage: 23:289/305 of query aligns to 1:271/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
27% identity, 88% coverage: 23:289/305 of query aligns to 1:271/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
27% identity, 88% coverage: 23:289/305 of query aligns to 1:271/293 of 8djfA
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
25% identity, 87% coverage: 25:289/305 of query aligns to 1:284/306 of 7rizA
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
26% identity, 87% coverage: 22:287/305 of query aligns to 2:251/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
26% identity, 87% coverage: 22:287/305 of query aligns to 2:251/289 of 7plbB
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
26% identity, 87% coverage: 22:287/305 of query aligns to 2:251/289 of Q9A9Z1
Q9M1B4 Protein STRICTOSIDINE SYNTHASE-LIKE 13; AtSSL13; Protein LESS ADHERENT POLLEN 3; Strictosidine synthase 11; AtSS11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 47% coverage: 104:247/305 of query aligns to 181:315/403 of Q9M1B4
Sites not aligning to the query:
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
24% identity, 83% coverage: 36:288/305 of query aligns to 17:270/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
24% identity, 83% coverage: 36:288/305 of query aligns to 17:270/307 of 5d9bA
>HSERO_RS20090 FitnessBrowser__HerbieS:HSERO_RS20090
MSLPETPFQHFDARFRRMVIDTAQVDCLYTGCRWAEGPVWLPATQELIWSDIPNNRLMRW
SEGAGAGVFRQPSNFNNGNTLDREGRIVGCLHGGRAVVRTEHDGSITTLASHWQGKRLNS
PNDVVVKSDGSIWFTDPDYGINSDYEGYQAQSEIGACNVYRIDGDSGEISIVASDLERPN
GLAFSTDERRLYIADTGLTHRAGGPHHIRVFDVVDGISLKVGEVFATIDPGLADGFRLDA
QGNVWTSAGDGVHCYAPDGTLLGKILIPEVVSNVVFGGPRGNRLFITATTSLYAVYLAVN
GAQRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory