Comparing HSERO_RS20635 FitnessBrowser__HerbieS:HSERO_RS20635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eiwA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-proline
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2eiwA
Sites not aligning to the query:
2j5nA 1-pyrroline-5-carboxylate dehydrogenase from thermus thermophirus with bound inhibitor glycine and NAD.
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2j5nA
Sites not aligning to the query:
2ej6A Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound d-proline
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2ej6A
Sites not aligning to the query:
2eitA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-alanine and NAD
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2eitA
Sites not aligning to the query:
2eiiA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-valine and NAD.
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2eiiA
Sites not aligning to the query:
2ehuA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NAD and inhibitor l-serine
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2ehuA
Sites not aligning to the query:
2ehqA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NADP (see paper)
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2ehqA
Sites not aligning to the query:
2bhqA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound product glutamate. (see paper)
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2bhqA
Sites not aligning to the query:
2bhpA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NAD. (see paper)
27% identity, 49% coverage: 197:469/561 of query aligns to 172:439/516 of 2bhpA
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8vqzA
8vqwC Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (coa bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8vqwC
8vj3A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (fad bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8vj3A
8uzoA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (adp bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8uzoA
8uznA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (amp bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8uznA
8uzmA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADPH bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8uzmA
8uzkA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (NADP+ bound)
25% identity, 69% coverage: 90:476/561 of query aligns to 43:412/488 of 8uzkA
8skfA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (lattice translocation disorder)
25% identity, 69% coverage: 90:476/561 of query aligns to 52:421/497 of 8skfA
Sites not aligning to the query:
4npiA 1.94 angstroms x-ray crystal structure of NAD- and intermediate- bound alpha-aminomuconate-epsilon-semialdehyde dehydrogenase from pseudomonas fluorescens (see paper)
25% identity, 52% coverage: 198:486/561 of query aligns to 141:423/483 of 4npiA
Sites not aligning to the query:
>HSERO_RS20635 FitnessBrowser__HerbieS:HSERO_RS20635
MPTDFFNRHRATLEQAVSALQQRGYWSPYNESPSPRFYGEGAAEAGRAAYEARLERPFLF
TPEQAGGDRWVGAEVSPYGPPLGIRYPAPDLDRLLPSMQRAAASWREAGPQVWAGVALEI
VQRLNARSFEIAHAVQHTTGQAFTMAFQAGGPHAQDRALEAIACAWQQLQLIPAEARWEK
PQGKHAPLVMRKTWRIVPRGIGLVIGCCTFPTWNSYPGLFANLATGNAVIVKPHPGAILP
LAITVQVAREVLAEAGFAPDVVTLAAHDASDTGLARTLALRHEIGLIDFTGSSANGDWLE
ERARQARVLTEKSGINQIIIDSTDNLAGMVQNIALSLALYSGQMCTTPQNIYIPRDGVRT
PQGQLSFVEVSQAIVQAVAHLTTDSAKAVELLGAIQNEAVLQRIELARGKGQVLLESTAL
VHPQFPGARVRTPLVMLARRNEAITEEYFGPISFIVPVDDTATAIALAQRIATDQGALTL
SAYTTDATLRQGLQHAAADAGVALSLNLTGGVLVNQSAAFSDYHGTGANPAANCTLTDAD
FVAARYRVVQTREPVASTTTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory