Comparing HSERO_RS21030 FitnessBrowser__HerbieS:HSERO_RS21030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A1X4 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase; UDP-3-O-(3-OHC14)-GlcN N-acyltransferase; UDP-3-O-(3-hydroxytetradecanoyl)glucosamine N-acyltransferase; EC 2.3.1.191 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 80% coverage: 1:136/170 of query aligns to 109:261/341 of P0A1X4
Sites not aligning to the query:
6p8aA E.Coli lpxd in complex with compound 8.1 (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p8aA
Sites not aligning to the query:
6p89A E.Coli lpxd in complex with compound 7 (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p89A
Sites not aligning to the query:
6p88A E.Coli lpxd in complex with compound 6 (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p88A
Sites not aligning to the query:
6p87A E.Coli lpxd in complex with compound 5 (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p87A
Sites not aligning to the query:
6p86A E.Coli lpxd in complex with compound 4.1 (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p86A
Sites not aligning to the query:
6p85A E.Coli lpxd in complex with compound 3 (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p85A
Sites not aligning to the query:
6p84A E.Coli lpxd in complex with compound 2o (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p84A
Sites not aligning to the query:
6p83A E.Coli lpxd in complex with compound 1o (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 114:259/335 of 6p83A
Sites not aligning to the query:
4ihgE Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 115:260/337 of 4ihgE
Sites not aligning to the query:
P21645 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase; UDP-3-O-(3-OHC14)-GlcN N-acyltransferase; Protein FirA; Rifampicin resistance protein; UDP-3-O-(3-hydroxytetradecanoyl)glucosamine N-acyltransferase; EC 2.3.1.191 from Escherichia coli (strain K12) (see 4 papers)
38% identity, 76% coverage: 8:136/170 of query aligns to 116:261/341 of P21645
Sites not aligning to the query:
4ihhE Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
38% identity, 76% coverage: 8:136/170 of query aligns to 117:262/340 of 4ihhE
Sites not aligning to the query:
4ihfA Chasing acyl carrier protein through a catalytic cycle of lipid a production (see paper)
37% identity, 76% coverage: 8:136/170 of query aligns to 114:259/336 of 4ihfA
Sites not aligning to the query:
6uecA Pseudomonas aeruginosa lpxd complex structure with ligand (see paper)
38% identity, 88% coverage: 4:152/170 of query aligns to 130:271/337 of 6uecA
Sites not aligning to the query:
3pmoA The structure of lpxd from pseudomonas aeruginosa at 1.3 a resolution (see paper)
38% identity, 88% coverage: 4:152/170 of query aligns to 150:291/357 of 3pmoA
Sites not aligning to the query:
2iu8A Chlamydia trachomatis lpxd with 25mm udpglcnac (complex i) (see paper)
34% identity, 84% coverage: 10:152/170 of query aligns to 143:291/346 of 2iu8A
Sites not aligning to the query:
P0CD76 UDP-3-O-acylglucosamine N-acyltransferase; EC 2.3.1.191 from Chlamydia trachomatis (strain D/UW-3/Cx) (see paper)
34% identity, 84% coverage: 10:152/170 of query aligns to 143:291/354 of P0CD76
7okbA Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 45 (see paper)
31% identity, 100% coverage: 1:170/170 of query aligns to 13:177/258 of 7okbA
7ok1A Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 3 (see paper)
31% identity, 100% coverage: 1:170/170 of query aligns to 13:177/258 of 7ok1A
7ojyA Crystal structure of pseudomonas aeruginosa lpxa in complex with compound 6 (see paper)
31% identity, 100% coverage: 1:170/170 of query aligns to 13:177/258 of 7ojyA
>HSERO_RS21030 FitnessBrowser__HerbieS:HSERO_RS21030
SVTIAPGVSIGEGVIIEDDVQIGENTRIETGALIGRGSRIGARSRIGARTVIGNEGLGSF
ETADGQLRNVRHLGNVRIGDDVEIGALCAVGRGTIDDTVIGNNTHIGPQVNIGHNSVIGM
RCQIAGRSHLSGSVVIEDEAKLWANCTLKDGVRIGAGATVGMGALVNHDV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory