Comparing HSERO_RS22735 FitnessBrowser__HerbieS:HSERO_RS22735 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
7ehpA Chitin oligosaccharide binding protein (see paper)
25% identity, 67% coverage: 128:409/420 of query aligns to 104:386/397 of 7ehpA
Sites not aligning to the query:
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
26% identity, 71% coverage: 32:331/420 of query aligns to 3:306/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
26% identity, 71% coverage: 32:331/420 of query aligns to 3:306/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
26% identity, 71% coverage: 32:331/420 of query aligns to 3:306/392 of 2b3bA
Sites not aligning to the query:
6preA Sbp rafe in complex with verbascose (see paper)
24% identity, 72% coverage: 30:333/420 of query aligns to 2:309/386 of 6preA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
24% identity, 72% coverage: 31:333/420 of query aligns to 2:308/385 of 2i58A
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
27% identity, 57% coverage: 31:270/420 of query aligns to 5:251/406 of 7ehqA
Sites not aligning to the query:
4zs9B Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with raffinose (see paper)
23% identity, 67% coverage: 53:335/420 of query aligns to 24:305/378 of 4zs9B
Sites not aligning to the query:
4zzeA Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with panose (see paper)
24% identity, 51% coverage: 122:335/420 of query aligns to 88:304/377 of 4zzeA
Sites not aligning to the query:
4zs9A Raffinose and panose binding protein from bifidobacterium animalis subsp. Lactis bl-04, bound with raffinose (see paper)
24% identity, 51% coverage: 122:335/420 of query aligns to 88:304/377 of 4zs9A
Sites not aligning to the query:
6fuvA Structure of a manno-oligosaccharide specific solute binding protein, blmnbp2 from bifidobacterium animalis subsp. Lactis atcc 27673 in complex with mannotriose (see paper)
27% identity, 66% coverage: 47:324/420 of query aligns to 44:328/427 of 6fuvA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
22% identity, 74% coverage: 49:359/420 of query aligns to 21:340/392 of 4g68A
Sites not aligning to the query:
6rjyA The crystal structure of abne, an arabino-oligosaccharide binding protein, in complex with arabinobiose (see paper)
21% identity, 66% coverage: 49:326/420 of query aligns to 21:310/415 of 6rjyA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
25% identity, 70% coverage: 118:410/420 of query aligns to 92:380/390 of 3oo6A
Sites not aligning to the query:
>HSERO_RS22735 FitnessBrowser__HerbieS:HSERO_RS22735
LPAFPRRPLLAACALALSLGSLAAAPSQAGTLTIESWRVDDLPLWQEVLIPAFQRSNPGI
TVKFSPTAPTEYDSSLAARMAGGTAGDLVACRPFDVSLSLYNKGHLEKLDGKPGMEFFAP
AAKAAWQTDDGRDTFCMPMASVIHGFFYNTKIFKELNLEPPKTEAEFFKLLDTVKANGKY
APLVMGTAEQWESHQVLFTSIGPNYWKGEEGRKALIAGKAKFTDPQFVAAWNYEAKLGKY
LPKGASAQTYSDSQNMFALGKGAVYPAGSWDIAYFNGKMDFAAFPPPVPKNGDACYISDH
NDIGMGINKKSKNKEDAYKFLAWLGSQEFADLYTNKVTGFFSLSNHLISVKDPIAKQMMG
WRKNCASTIRVNSQILNRGTPSMENEMWNVNAQVLNGKMTPQDAAAKIQSGFAKWYKPQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory