Comparing HSERO_RS22840 FitnessBrowser__HerbieS:HSERO_RS22840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
32% identity, 98% coverage: 1:301/306 of query aligns to 1:315/325 of 6t3eB
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
32% identity, 96% coverage: 3:297/306 of query aligns to 6:297/303 of 4bvaA
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
31% identity, 96% coverage: 3:297/306 of query aligns to 5:298/303 of 4bv9A
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
34% identity, 75% coverage: 67:297/306 of query aligns to 86:307/314 of Q14894
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
34% identity, 75% coverage: 67:297/306 of query aligns to 85:306/312 of 2i99A
Sites not aligning to the query:
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 74% coverage: 79:303/306 of query aligns to 93:324/325 of Q9FLY0
Sites not aligning to the query:
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
33% identity, 70% coverage: 79:293/306 of query aligns to 91:304/322 of 6rqaB
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
33% identity, 70% coverage: 79:293/306 of query aligns to 91:304/322 of 6rqaA
Sites not aligning to the query:
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
33% identity, 70% coverage: 79:293/306 of query aligns to 89:302/320 of A1B8Z0
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
28% identity, 98% coverage: 3:303/306 of query aligns to 5:311/322 of O28608
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
28% identity, 98% coverage: 3:303/306 of query aligns to 5:311/320 of 1omoA
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
25% identity, 74% coverage: 76:300/306 of query aligns to 96:322/334 of 4mp6A
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
24% identity, 74% coverage: 76:300/306 of query aligns to 91:298/310 of 4m54A
Sites not aligning to the query:
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
27% identity, 74% coverage: 79:303/306 of query aligns to 90:313/341 of 1u7hA
Sites not aligning to the query:
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
27% identity, 74% coverage: 79:303/306 of query aligns to 90:313/340 of 1x7dA
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
28% identity, 74% coverage: 79:303/306 of query aligns to 91:314/350 of Q88H32
Sites not aligning to the query:
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
24% identity, 74% coverage: 76:300/306 of query aligns to 84:306/318 of 4mpdA
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
35% identity, 45% coverage: 80:218/306 of query aligns to 101:243/344 of 5yu4A
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
35% identity, 45% coverage: 80:218/306 of query aligns to 101:243/344 of 5yu3A
Sites not aligning to the query:
8j1cA Structure of amino acid dehydrogenase in complex with NADP (see paper)
28% identity, 95% coverage: 8:298/306 of query aligns to 9:297/300 of 8j1cA
>HSERO_RS22840 FitnessBrowser__HerbieS:HSERO_RS22840
MKFLSNQQISELLTTEDAIAAMREAFAGAAEGAHQGRVRTSASNGVMLSMMGAVIPAAGI
AGAKVYTTIKGQFRFVIQLFSTETGAPLCTMEGDAMTGLRTAAATAVACDALARPDAGVL
AVIGTGVQARSHIPALLQVRPFKEVLIAGRSGQQALAEEVTRTLGVPARMVSIDEAAAQA
DVLVTVTRSATPLFDGELLRPGAFVAAVGASKANVRELDDTAIGRAAALFVEWKPQAQQE
AGDLVQCAPGVFDWAQVMELAQAVDGSMPYQRRPDDIVIYKGIGIGLEDVALAGLAYRKA
CARYGW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory