Other sequence analysis tools:
Find papers: PaperBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Comparing LRK54_RS03535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree
Found 10 hits to proteins with known functional sites (download)
7unr1 50S ribosomal protein L36
53% identity, 93% coverage: 1:57/61 of query aligns to 1:57/61 of 7unr1
5adyY Cryo-em structures of the 50s ribosome subunit bound with hflx (see paper)
55% identity, 98% coverage: 1:60/61 of query aligns to 1:60/63 of 5adyY
6spbY Pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 (see paper)
63% identity, 67% coverage: 17:57/61 of query aligns to 20:57/60 of 6spbY
Sites not aligning to the query:
9c4gx Cutibacterium acnes 50s ribosomal subunit with clindamycin bound (see paper)
40% identity, 93% coverage: 1:57/61 of query aligns to 2:58/69 of 9c4gx
Sites not aligning to the query:
8buuY 50S ribosomal protein L13 (see paper)
39% identity, 93% coverage: 1:57/61 of query aligns to 1:57/66 of 8buuY
Sites not aligning to the query:
6v39X 30S ribosomal protein S18 (see paper)
41% identity, 95% coverage: 3:60/61 of query aligns to 2:59/62 of 6v39X
7asmW Staphylococcus aureus 50s after 30 minutes incubation at 37c
37% identity, 89% coverage: 3:56/61 of query aligns to 2:55/67 of 7asmW
Sites not aligning to the query:
8uu51 Small ribosomal subunit protein uS9 (see paper)
40% identity, 90% coverage: 3:57/61 of query aligns to 2:56/61 of 8uu51
Sites not aligning to the query:
5myjB1 of 70S ribosome from Lactococcus lactis (see paper)
42% identity, 87% coverage: 4:56/61 of query aligns to 10:62/67 of 5myjB1
Sites not aligning to the query:
7mscY 70SIC in complex with MtbEttA at Pre_R0 state (see paper)
39% identity, 93% coverage: 1:57/61 of query aligns to 1:57/68 of 7mscY
Sites not aligning to the query:
>LRK54_RS03535
MASKDINNQSAEELQQHLLDLRKEQFNLRMQKGSGQLTQPHQLRRVRRDIARTKFVLGGK
K
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory