Comparing MMJJ_RS07505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O88828 DNA-directed RNA polymerases I, II, and III subunit RPABC2; RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerase II subunit F; RPB6 homolog from Rattus norvegicus (Rat) (see paper)
40% identity, 89% coverage: 3:53/57 of query aligns to 57:108/127 of O88828
Sites not aligning to the query:
>MMJJ_RS07505
MKLTKFETARLIGARSLQISDGAPLAIESEKTSSLDLADDEVKQGKLPLCVKKQAKN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory