Comparing N515DRAFT_0145 FitnessBrowser__Dyella79:N515DRAFT_0145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
55% identity, 98% coverage: 10:452/453 of query aligns to 6:450/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
55% identity, 98% coverage: 10:452/453 of query aligns to 5:449/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
55% identity, 98% coverage: 10:452/453 of query aligns to 5:449/450 of 3mduA
4f0lB Crystal structure of amidohydrolase from brucella melitensis
49% identity, 93% coverage: 10:430/453 of query aligns to 7:434/449 of 4f0lB
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
24% identity, 90% coverage: 25:430/453 of query aligns to 36:416/441 of 3lnpA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
24% identity, 87% coverage: 47:442/453 of query aligns to 58:424/436 of 4f0rA
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
24% identity, 87% coverage: 47:442/453 of query aligns to 58:424/434 of 4f0sA
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
24% identity, 89% coverage: 44:444/453 of query aligns to 56:427/437 of 4dykA
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
24% identity, 89% coverage: 44:444/453 of query aligns to 56:427/435 of 4gbdA
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
25% identity, 92% coverage: 36:450/453 of query aligns to 51:436/439 of 4dzhA
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
24% identity, 79% coverage: 34:390/453 of query aligns to 45:387/452 of 8is4A
2i9uA Crystal structure of guanine deaminase from c. Acetobutylicum with bound guanine in the active site
22% identity, 83% coverage: 47:424/453 of query aligns to 57:416/419 of 2i9uA
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
21% identity, 85% coverage: 48:430/453 of query aligns to 48:396/420 of Q58936
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
25% identity, 84% coverage: 15:394/453 of query aligns to 21:400/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
25% identity, 84% coverage: 15:394/453 of query aligns to 21:400/474 of P72156
2imrA Crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans
29% identity, 42% coverage: 186:374/453 of query aligns to 157:360/380 of 2imrA
Sites not aligning to the query:
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
24% identity, 84% coverage: 15:394/453 of query aligns to 21:400/474 of Q9EYU0
6ohbA E. Coli guanine deaminase (see paper)
22% identity, 81% coverage: 44:409/453 of query aligns to 67:410/435 of 6ohbA
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
22% identity, 92% coverage: 36:453/453 of query aligns to 43:426/428 of 3hpaA
>N515DRAFT_0145 FitnessBrowser__Dyella79:N515DRAFT_0145
MSDATRTYSADQLWLADGWSADGAFAVDASGHVAPPEGEAERLGAWVLPGMPNLHSHAFQ
RAMAGLAERKGRSDDSFWTWRETMYAFAAAIGPEELKAIAAQLYVEMLKAGYTQVCEFHY
LHHQPDGTPYAQPEAMSLALIEAARETGITLTLLPVLYMTGGFDGRPLSARQRRFGNDLS
SYVRLLEALRRHEGDGLRIGIALHSLRAVPEEAMRGLLATRIAQDLPVHIHIAEQIGEVQ
DCLATRGARPVEWLLDHAPVDARWTLVHATHLTGHETSRLARSGAVAGLCPTTEANLGDG
LFPLSDYLDAKGVLGIGSDSHISISPVEELRWLEYGQRLSTRHRNIAARREGDSVGETLW
RAALRGGARAAGLPVGELRAAARADLLVLDDESPLLAARDARSLLDSFLFAGNTPLVRHV
MCGGRWVVRDFRHHDEAGIAARYRAVVERLAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory